KEGG   Felis catus (domestic cat): 101097142Help
Entry
101097142         CDS       T02385                                 

Gene name
GATB
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X2
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00970  Aminoacyl-tRNA biosynthesis
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101097142 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101097142 (GATB)
Enzymes [BR:fca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     101097142 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     101097142 (GATB)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101097142 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey TMEM251
Motif
Other DBs
NCBI-GeneID: 101097142
NCBI-ProteinID: XP_003984991
Ensembl: ENSFCAG00000003207
UniProt: M3VZX5
Position
B1
AA seq 557 aa AA seqDB search
MAAPMLRGRCLGRCWALACIDSGSRHGRGAATGFTSSRKRGQSFVAQQPLLTAQKSRKGE
HKWAAVVGLEIHAQIASNSKLFSGSQVHFAAPPNSLVSFFDASLPGTLPVLNRRCVEAAV
MTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLAYSVCVGKKWRQVIT
KTVRIKQIQLEQDSGKSLHDELRSQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQ
LILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSARFLARAIDYEIQRQI
NELENGCEILNETRSFDYKLGCTVPMRDKEGKQDYRFMPEPNLPPLLLYDTASLPAGADP
QQVINIDRIREQLPELPSETREKLIQQYGILPEHSFALLNEVGLLEFFQNVIKETRAEPK
KVTSWVLNIFLGFLKQRNLAVNESPVTPSVLAELLNLLDRKVISSAAAKQVFEELWRSKG
KTPSQIVSERKLELMQDEEALERVCHAVMEGHPQVVMDMKRGNPRAINKLIGLVRKVTHN
RADPTVIKEILEKQLSS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccatgctgcgcgggcgctgccttggaaggtgttgggctttagcctgcatt
gacagcggttctcgccacggaagaggggccgcgactgggttcacgtccagcaggaaaagg
ggacagagcttcgtggctcagcagcccctcctcacggcccagaagtcaaggaaaggtgaa
cacaaatgggcagctgtggtaggtttggaaattcatgcccagattgcctccaactctaaa
ctcttctctggatctcaagtccactttgcagcacctcccaattctttggtatcttttttt
gatgcatctctgcctggaactctgccggttctcaacaggagatgcgtcgaagcggcggtg
atgacaggcctggcactgaactgccacataaacaagaagtccttgtttgacaggaagcac
tacttctatgcagacctccctgcaggctaccaaattactcagcagagactcccgattgct
gtgaatgggagcctggcatacagtgtctgtgtggggaagaaatggaggcaggtgatcacc
aagaccgtgaggatcaagcagatccagctggagcaagacagtggcaaaagcctccacgat
gagctgcggtctcagacactcatcgatttgaacagggcaggagttggccttctggaagtg
gtgctggagccggacatgtcctgtggagaagaggcagcaacagccgtcagagagctgcag
ctgatacttcaagcactggggaccagccaggcaaatatggcagagggccagttaagagtg
gatgccaacatatctgtgcatcatcctggggagcctttgggcgttcgaactgaagtgaag
aatctcaacagtgccaggttcctggccagagcaatagactatgaaattcagagacaaatc
aacgaacttgagaatggatgtgaaattctgaatgaaactcgctcgtttgactacaagcta
gggtgcactgtaccgatgagagacaaagaaggaaaacaagactacaggtttatgcccgaa
cccaaccttcctcccctgctgctctatgacactgcatctctgcctgctggtgcagacccg
cagcaagtgatcaacattgaccggattcgggagcagctccctgagctccccagtgagacc
cgagagaagctcattcaacagtatgggatactgccagaacacagcttcgccttactgaat
gaagttggcctactggagttcttccagaatgtgataaaagaaactagggcagagccaaaa
aaagtaactagttgggtcctcaacatttttctgggttttttaaagcaacggaaccttgct
gtcaatgagagtcctgtcacaccttctgtgctggctgagcttctcaacctgctggacaga
aaagtaatttcttcggcagcagctaaacaggtgtttgaggaattgtggaggagtaaaggg
aagactccatcacagattgtttcagaaaggaagcttgaactgatgcaggatgaagaggca
ctggaacgggtgtgccacgccgtgatggaggggcatcctcaagtggtgatggacatgaag
aggggaaaccccagagccataaacaaactgattgggttggtacgaaaagtaactcacaac
cgagcagatcctacggtgataaaggagatcctggagaagcagttgtcgtcatga

DBGET integrated database retrieval system