KEGG   Felis catus (domestic cat): 101097250Help
Entry
101097250         CDS       T02385                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04921  Oxytocin signaling pathway
fca04925  Aldosterone synthesis and secretion
fca05214  Glioma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101097250 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101097250 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    101097250 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    101097250 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101097250 (CAMK1D)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101097250 (CAMK1D)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101097250 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 5_nucleotid Tyrosinase
Motif
Other DBs
NCBI-GeneID: 101097250
NCBI-ProteinID: XP_019689487
UniProt: M3WLG6
Position
B4
AA seq 385 aa AA seqDB search
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKASGRLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPATVTTVHSGSK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagctgaagacatcaag
aaaattttcgagttcaaggagaccctcgggaccggggcgttttctgaagtggtcttagcc
gaagagaaggcgagtggcaggctctttgcggtgaagtgcatcccgaagaaggcgctgaaa
ggcaaggagagcagcatagagaacgagatagcagttctgagaaagatcaagcatgaaaac
atcgttgccctggaagacatttacgaaagcccaaatcacttgtacttggtcatgcagctc
gtatccggtggagagctgtttgatcggatagtggagaaaggattttacacagagaaagat
gccagcaccctcatccgccaggtcttggatgccgtctactatctccatagaatgggcatt
gtccacagggacctcaagcctgaaaacctcttgtactacagtcaagacgaggaatcgaaa
ataatgatcagtgactttggactgtcaaaaatggagggcaaaggagatgtgatgtccaca
gcctgtggcaccccgggctatgttgctcctgaggtcctggcccagaaaccgtacagcaaa
gctgtggactgctggtccatcggggtgattgcctatatcttgctctgcggctaccctccc
ttttacgatgaaaatgactccaagctctttgagcagatcctcaaggcggaatatgagttt
gactcgccctattgggacgacatctctgactctgcaaaagatttcattcggaatctgatg
gagaaagatccaaataaaagatacacttgtgagcaagccgctcggcacccatggatcgct
ggtgacacagccctcaacaaaaacatccacgagtctgtcagtgcccagatccggaagaac
ttcgcaaaaagcaaatggagacaagcatttaatgccacggccgttgtgagacatatgagg
aaactccatctcggcagcagcctggacagttcaaatgcaagcgtttcaagcagcctcagt
ttggcgagccaaaaagattgtctggcaccctccacgctctgtagtttcatttcttcttca
tccggggtctcaggagtgggggcggagcggagaccgaggcccgccactgtgaccacagtg
cactccgggagcaagtga

DBGET integrated database retrieval system