KEGG   Felis catus (domestic cat): 101097289Help
Entry
101097289         CDS       T02385                                 

Gene name
USP12
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 12 isoform X1
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101097289 (USP12)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101097289 (USP12)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101097289 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 NapB
Motif
Other DBs
NCBI-GeneID: 101097289
NCBI-ProteinID: XP_023105986
Ensembl: ENSFCAG00000026620
Position
A1
AA seq 250 aa AA seqDB search
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNSSPPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagatgcccatgaattcttaaattacctactaaatacaattgctgatatctta
caagaagagagaaagcaggaaaagcaaaatggccgtttacccaacggtaatatcgacagc
gaaaataacagcagcccaccagacccaacgtgggttcatgagatttttcagggaacatta
acaaatgaaaccagatgtcttacttgtgaaaccataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcgatcactcactgcttaaggggttttagc
aacacagaaactctgtgcagtgaatacaaatattactgtgaagaatgtcgcagcaaacag
gaggcacacaaacggatgaaagttaaaaaactgcccatgattctagctctgcacctgaag
aggtttaagtacatggatcaacttcatcgatacacaaaactgtcttaccgggtagttttt
cctttagaacttcgtctgtttaacacctctggcgacgcaaccaatcctgacagaatgtac
gacctcgtcgccgtggtggttcactgtggaagtggtcccaatcgaggacattatatcgca
atagttaagagtcatgatttttggttgttgtttgatgacgacattgtagaaaaaattgat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system