KEGG   Felis catus (domestic cat): 101097420Help
Entry
101097420         CDS       T02385                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04730  Long-term depression
fca04740  Olfactory transduction
fca04923  Regulation of lipolysis in adipocytes
fca04970  Salivary secretion
Module
fca_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    101097420 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101097420 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101097420 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101097420 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    101097420 (PRKG1)
  Digestive system
   04970 Salivary secretion
    101097420 (PRKG1)
  Nervous system
   04730 Long-term depression
    101097420 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    101097420 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    101097420 (PRKG1)
   04714 Thermogenesis
    101097420 (PRKG1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101097420 (PRKG1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKG family
   101097420 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Med4 Kinase-like APH Pkinase_C DUF4200 Spc7 NPV_P10 PKcGMP_CC Tsc35
Motif
Other DBs
NCBI-GeneID: 101097420
NCBI-ProteinID: XP_023096055
Position
D2
AA seq 686 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSAGTLQGEPRTKRQAISAEPTAFDLQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEVCLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYTKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIVK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDSDEPPPDDNSGWDIDF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgcgggatttgcagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgcgctcatcgacgagctggagctggagttggaccagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggccggccacccagcaggcg
cagaagcagagcgccggcacgctgcagggcgagccgcgcaccaagcgccaggcgatctcc
gccgagcccaccgccttcgacctgcaggacctcagccacgtgaccctgcccttctacccc
aagagcccacagtccaaggatctcatcaaggaagctatccttgacaatgactttatgaag
aacttggagctgtcgcagatccaggagattgtggattgtatgtacccagtggaatatggc
aaagacagctgcatcatcaaagaaggagacgtggggtcactggtgtatgtcatggaagat
ggtaaggtggaagtcaccaaagaaggtgtgaagctgtgcaccatgggtccaggaaaggtg
ttcggagagctggcaattctttacaactgtacccggacagctaccgtcaagactcttgtg
aatgtgaaactctgggccatcgatcgacaatgttttcaaacaatcatgatgaggacagga
ctcatcaaacacaccgagtatatggaatttttaaaaagtgtcccaacgttccagagcctt
cctgaagagatcctcagtaagcttgccgatgtcctcgaagagacccactatgagaatggg
gagtatatcatcaggcaaggtgccagaggggacacgttctttatcatcagcaaaggcacg
gtaaatgtcactcgggaagactcaccaagtgaagacccggtctttcttagaactttaggg
aaaggagactggtttggagagaaggcattgcaaggggaggatgtgaggacagccaacgta
atcgctgcagaggctgtgacctgcctggtcatcgacagagactctttcaagcatttgatt
ggaggactggatgacgtgtctaataaagcctatgaggacgcagaagctaaagcaaaatac
gaagccgaagccgctttcttcgccaacctgaagctgtctgacttcaacatcatcgacacc
cttggagtcgggggcttcggacgagtggagctggtccagctgaaaagcgaggagtccaag
acgtttgccatgaagattctcaagaaacgccacatcgtggacaccagacaacaggagcac
attcgctcggagaagcagatcatgcagggggctcattccgacttcatagtgagactgtac
aggacgttcaaggacagcaaatatttgtatatgttgatggaagtgtgcctaggtggagag
ctctggaccattctcagggatagaggttcgtttgaagattctacgaccagattctacacc
gcgtgtgtggtggaagccttcgcctatctgcattccaaaggaatcatttacagggacctc
aagccagaaaatctcatcctggatcaccgaggctacaccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtacgtg
gctccagagatcatcctgaacaaaggccatgacatttcagccgactactggtcactggga
atcctaatgtatgaacttctgactggcagcccgccattctcaggcccagaccctatgaaa
acctataacatcatactgagggggattgacatgatagaatttccaaagaagattgtcaaa
aatgctgctaatttaattaaaaaactatgcagggataacccatcggaaagactagggaat
ttgaaaaatggcgtcaaagacattcaaaagcacaaatggtttgagggctttaactgggaa
ggcttaagaaaaggcaccttgacacctcctataataccaagcgttgcatcacccacagac
acaagcaattttgacagtttccctgaggacagtgatgaaccaccacctgacgacaactcg
ggctgggacatagacttctaa

DBGET integrated database retrieval system