KEGG   Felis catus (domestic cat): 101097765Help
Entry
101097765         CDS       T02385                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer's disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101097765 (PPP3R2)
   04310 Wnt signaling pathway
    101097765 (PPP3R2)
   04370 VEGF signaling pathway
    101097765 (PPP3R2)
   04020 Calcium signaling pathway
    101097765 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    101097765 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101097765 (PPP3R2)
   04218 Cellular senescence
    101097765 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    101097765 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    101097765 (PPP3R2)
   04660 T cell receptor signaling pathway
    101097765 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    101097765 (PPP3R2)
   04659 Th17 cell differentiation
    101097765 (PPP3R2)
   04662 B cell receptor signaling pathway
    101097765 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    101097765 (PPP3R2)
   04921 Oxytocin signaling pathway
    101097765 (PPP3R2)
   04924 Renin secretion
    101097765 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    101097765 (PPP3R2)
   04720 Long-term potentiation
    101097765 (PPP3R2)
  Development
   04360 Axon guidance
    101097765 (PPP3R2)
   04380 Osteoclast differentiation
    101097765 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101097765 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    101097765 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    101097765 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    101097765 (PPP3R2)
   05166 HTLV-I infection
    101097765 (PPP3R2)
   05163 Human cytomegalovirus infection
    101097765 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101097765 (PPP3R2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101097765 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 101097765
NCBI-ProteinID: XP_003995756
Position
D4
AA seq 170 aa AA seqDB search
MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID
VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagctagttacccgacggagatgtgttcccacttcaaccacgatgaaatt
aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg
gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac
gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc
cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac
atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg
gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg
gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg
gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system