KEGG   Felis catus (domestic cat): 101097773Help
Entry
101097773         CDS       T02385                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X2
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04071  Sphingolipid signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101097773 (TRADD)
   04064 NF-kappa B signaling pathway
    101097773 (TRADD)
   04668 TNF signaling pathway
    101097773 (TRADD)
   04071 Sphingolipid signaling pathway
    101097773 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101097773 (TRADD)
   04217 Necroptosis
    101097773 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101097773 (TRADD)
   04657 IL-17 signaling pathway
    101097773 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101097773 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101097773 (TRADD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101097773 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101097773 (TRADD)
   05162 Measles
    101097773 (TRADD)
   05164 Influenza A
    101097773 (TRADD)
   05160 Hepatitis C
    101097773 (TRADD)
   05168 Herpes simplex virus 1 infection
    101097773 (TRADD)
   05163 Human cytomegalovirus infection
    101097773 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097773 (TRADD)
   05169 Epstein-Barr virus infection
    101097773 (TRADD)
   05165 Human papillomavirus infection
    101097773 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death
Motif
Other DBs
NCBI-GeneID: 101097773
NCBI-ProteinID: XP_003998167
Ensembl: ENSFCAG00000024157
UniProt: A0A337S5N8
Position
E2
AA seq 311 aa AA seqDB search
MASGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALRTALAESVGSPEMLQ
MLKIHRSEPQLIVQVRFCGRQPCSRFLRAYREGALRAALQGCLAAALAQHSVPLELELRA
GVERLDTLLTDEERCLSCIFAQKPDRLRDDELSELEDALRNLTCGSGGQGSDVEVAPVPS
QSLDASFSDEKPPPPPSGQTFLFQGQPIVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLANPDGGLA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgggccaaatgggctcgaggagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggataaagtggtcctgtctgatgcctacgctcacccccagcagaaggtggcg
gtgtacagggctctgcggactgcactggcagagagtgttgggagtccggagatgctgcag
atgctcaagatccaccgcagtgaaccgcagctgattgtgcaggtgcgtttctgcggacgc
cagccctgcagccgcttcctgcgcgcttatcgcgagggggcgctgcgcgccgcgctgcaa
gggtgcttggcagcagcactcgcccagcattcggtgccgttggaactggagctgcgcgct
ggcgtggagcgactggataccttgctgacggatgaagagcgctgtttgagttgcatcttc
gctcagaagcctgaccggctccgggacgacgagctctctgagttagaggatgcgctccgg
aatctgacatgcggctcagggggccagggtagcgacgtggaggtcgctccggtgccctcg
cagtccctggatgcctctttctcagacgagaagccgccgccgccgccatctggccagact
tttctgttccagggtcagcccatagtgaaccggccgctgagcctgcaggaccaacagacg
ttcgcgcgctcagtaggcctcaagtggcgcaaagtggggcgctccttgcagcgaggctgt
cgtgcgctgcgggacccggcgctcgactcactggcctatgagtacgagcgcgacgggctg
tacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggtcgccgcgccacg
ctgcagcgcctggtagaggcactagaggagaacgagctcaccagcctggcagaggacttg
ctgggcctggcgaatcccgatggcggcctggcgtag

DBGET integrated database retrieval system