KEGG   Felis catus (domestic cat): 101097852
Entry
101097852         CDS       T02385                                 

Gene name
MLX
Definition
(RefSeq) max-like protein X isoform X2
  KO
K09113  MAX-like protein X
Organism
fca  Felis catus (domestic cat)
Pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101097852 (MLX)
   04931 Insulin resistance
    101097852 (MLX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097852 (MLX)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    101097852 (MLX)
SSDB
Motif
Pfam: HLH DUF3322
Other DBs
NCBI-GeneID: 101097852
NCBI-ProteinID: XP_003996941
Ensembl: ENSFCAG00000011667
UniProt: A0A337SNT3
Position
E1
AA seq 288 aa
MRGPCPALRLSFVGWWVWVTWKCLASSSRQGARPLAGFRFGGSEMTEPVASPDDPWVKVE
YAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQESYKESYKDRR
RRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKE
KKKQEEEVSMLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF
QSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcgcgggccgtgccccgccctccgcctctcgttcgtgggttggtgggtttgggtcacg
tggaagtgcctcgcctcttcctcgcggcagggggcccgcccgctggctggtttccggttc
ggtgggtcggagatgacggagccggtcgcctctccggacgacccctgggtcaaggtggag
tatgcctacagtgacaacagcctggaccccgggctttttgtagaaagtacccgaaagggg
agtgtagtgtccagagctaatagcatcggttccaccagtgcctcttctgtccccaataca
gatgacgaggacagtgattaccaccaggagtcctacaaggagtcctacaaggaccggcgg
cggcgagcacatactcaggctgagcagaagaggagagacgccatcaagagaggctatgat
gacctccagaccatcgtccccacctgccagcagcaggacttctccattggctcccaaaag
ctcagcaaagccatcgttctacagaagactattgactacatccagtttttgcacaaggag
aagaaaaagcaggaggaggaggtgtccatgctacgcaaggacgtcacggccctaaagatc
atgaaagtgaactatgagcagattgtgaaggcacaccaggacaacccccatgagggagaa
gaccaggtctctgaccaagtcaagttcaatgtgtttcaaggcatcatggactcactgttc
cagtccttcaatgcctctatctccgtggccagtttccaggagctgtcagcctgtgtcttc
agctggattgaggagcactgtaagcctcagaccctacgggagattgtgattggcgtcttg
caccaattgaagaaccagctgtactga

DBGET integrated database retrieval system