KEGG   Felis catus (domestic cat): 101097902Help
Entry
101097902         CDS       T02385                                 

Gene name
NR4A1
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101097902 (NR4A1)
   04151 PI3K-Akt signaling pathway
    101097902 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101097902 (NR4A1)
   04927 Cortisol synthesis and secretion
    101097902 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101097902 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097902 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101097902 (NR4A1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    101097902 (NR4A1)
Nuclear receptors [BR:fca03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   101097902 (NR4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 101097902
NCBI-ProteinID: XP_003988775
Ensembl: ENSFCAG00000000268
UniProt: M3VUE4
Position
B4
AA seq 598 aa AA seqDB search
MPCIQAQYGTPAPSPGSRDHLASDPLTPELSKPTMDLASPEAAPTAPTALPSFSTFMDGY
TGEFDTFLYQLPGTAQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSAPL
DETLSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGPFSPSQTYEGLRAWTEQLPKA
SGHPQPPAFFSFSPPAGPSPSLVQSPLKLFPTQAPCQLGERESYSMSAAFPGLAPTSPHL
DGPGMLDVPVPSAKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSSSLEVIRKW
AEKIPGFAELSPGDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCAPGFG
DWIDSILAFSRSLHGLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVS
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccgagcccaggatcccgtgaccac
ctggcaagcgaccccctgacccccgagctcagcaagcccaccatggacctggccagccct
gaggcagcccccactgcccccactgccctgcctagcttcagcaccttcatggatggctac
acaggagagtttgacaccttcctctaccagctgccgggaacagcccagccatgttcctcg
gcctcctcttcggcctcctccacatcctcatcctcggccacctcccctgcctctgcttct
ttcaagtttgaggacttccaggtgtacggctgctatcctggcccgttgagcgcccccctg
gatgagaccctgtcctccagtggctccgactactatggcagcccctgctcagcaccgtca
ccgtccacgcccagcttccagccgccccagctgtctccctgggacggctcattcggcccc
ttctcacccagccagacgtatgaaggcctgcgggcatggacagagcagctgcccaaggct
tctgggcacccccagccaccggccttcttttccttcagcccccccgccggccccagcccc
agccttgtccaaagccccttgaagctattccccacacaggccccctgccagctgggggag
agagagagttattccatgtcggcggctttcccaggcctggcgcccacttctccacacctg
gatggcccagggatgctggatgtacctgtgccctctgccaaggcccggagcggggctcca
ggtggaagcgagggccgctgtgccgtgtgtggcgacaatgcttcgtgccagcattatggt
gtccgcacctgcgagggctgcaagggcttcttcaagcgcacagtgcagaaaaacgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggccgtaggcatggtgaaggaagttgtccggacagac
agcctgaagggacggcgggggcggctcccttcaaagcccaagcagcccccagatgcctct
cctgccaatctcctcacctccctggtcagggcgcacctggactcggggcccagcacggcc
aaactggattactccaagttccaggagctggtgctgccccactttgggaaggaagatgct
ggggatgtgcagcagttctatgacctgctttcgagttccctggaggttatccgcaagtgg
gccgagaagatccccggctttgctgagctgtccccgggggaccaggacctgctgctggag
tcagccttcctggaactcttcatcctccgcctggcctaccggtccaagcctgccgagggg
aaactcatcttctgctcaggcctggtgctgcaccggctccagtgcgcccctggctttggc
gactggatcgacagcatcctggccttctctcggtccctgcacggcttggtggtcgacgtc
cctgccttcgcctgcctctctgcactcgtcctcatcacggaccggcacgggctgcaggag
ccccggcgggtggaggaacttcagaaccgcattgccagctgcctgaaggagcacgtctcg
gccgtggcgggcgagccccagccagccagctgcctgtcacgcctgctgggcaagctgccc
gagcttcggaccctgtgcacccagggcctgcaacgcatcttctacctcaagctggaggac
ctggtgccccctccacccatcgtcgacaagatctttatggacacgctgcccttctga

DBGET integrated database retrieval system