KEGG   Felis catus (domestic cat): 101098329Help
Entry
101098329         CDS       T02385                                 

Gene name
RASA2
Definition
(RefSeq) ras GTPase-activating protein 2 isoform X1
  KO
K08053  Ras GTPase-activating protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101098329 (RASA2)
   04010 MAPK signaling pathway
    101098329 (RASA2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101098329 (RASA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 RasGAP BTK PH Sec3-PIP2_bind
Motif
Other DBs
NCBI-GeneID: 101098329
NCBI-ProteinID: XP_023116280
Ensembl: ENSFCAG00000002561
Position
C2
AA seq 854 aa AA seqDB search
MAAAAPAAAAASSEAPATSGTAEPEAGDEDSREVRVLQSLRGKICEAKNLLPYLGPNKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGK
VAIKKEDLCNHSGKETWFLLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIVSC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQ
FQVEEEDIEKLEIRIDLWNNGNLVQDIFLGEIKVPVNVLRNDSSHQAWYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILGEICRDKNDA
VLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
TLKPILDEICESSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFSTIVKSSMSCPTVMCD
TFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTL
ISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEERYIIAVKKFLDEISSTETKESSGT
SEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGKFIERKDAIYTIPVK
NILAVEKLEESSFNKKNMFQVIHMEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYH
PSAYLNGNWLCCLETSENALGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKM
EEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIKQIKSIIEKLDEPHEKYRKKRSTSA
KYGSKENPIVGKTS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgcctgctgctgcggcggcttcttccgaggcgccggcgacgagtggg
acggctgagcccgaggccggggacgaggacagtcgcgaggtccgagtgctgcagagcctg
cggggcaagatctgtgaagcaaaaaatttattgccatatcttggacccaacaaaatgaga
gattgtttctgcaccataaatttggaccaggaagaagtttatcgtacccaagttgttgaa
aagtctttaagcccatttttcagtgaagaattttactttgagattccaagaactttccag
tatttgtctttctatgtttatgataagaatgttttacaaagagaccttcgtataggaaaa
gtagccatcaaaaaagaagacttatgtaaccacagtggcaaagaaacttggtttttacta
cagcctgttgactccaattcagaggttcagggtaaagttcaccttgaattaaaactgaat
gaactgataacagagaatggaactgtgtgccagcagcttgttgtacacatcgtgtcatgt
cacgggttgcctctcataaatggacaaagctgtgacccttatgcaacagtttctctagtg
ggcccttctaggaatgaccaaaagaagacaaaagtaaagaagaaaacaagcaatccgcag
tttaatgaaatcttttattttgaggtaacaagatccagtagttataccagaaagtcccaa
ttccaggtagaagaggaggacatcgaaaagctagaaattaggatcgacttgtggaacaat
ggaaacctggtccaggatattttcctaggggagattaaggttcctgtgaatgtgttaaga
aacgattcctctcatcaagcctggtacttgctacaaccaagagacaatggaaacaagtcg
tctaaaactgatgatctggggtctcttagattaaatatatgttatacagaagactacgta
cttccttcagagtactatggtcctttgaaaactttgctgctaaagtcaccagatgttcag
ccaatatctgcctcagctgcttacattttgggtgaaatttgtcgagataaaaatgatgct
gttttgccccttgtccgactgctgctgcatcacgataaacttgttccttttgccactgca
gtggctgaattagacttgaaggatacacaagatgcaaatacaatttttagaggaaattcc
ttggctacccgatgtctggatgagatgatgaaaatagtgggagggcactacctgaaagta
acattaaaacctattctagatgagatatgtgaatcctcaaaatcctgtgaaattgatcct
attaaattgaaagagggagataatgtagaaaacaataaggagaatctgcgctactatgta
gacaagttattcagtacgattgtaaaatcaagtatgagctgccccactgtaatgtgtgat
accttttattccctaaggcaaatggctactcagcgatttcctaatgaccctcatgttcag
tattctgcagtgagcagctttgtatttcttcgtttctttgctgtagccgtagtatcacct
catacttttcatttgcgacctcatcatccagatgcacagacaattagaacattaactctc
atctcaaaaaccattcaaacattgggaagctggggaagtctgtccaaaagcaagtcaagt
ttcaaagagacattcatgtgtgaatttttcaaaatgtttcaagaagaacgatatattata
gcagttaaaaagttcttggatgaaatttcatcaactgaaactaaagagtccagtggtacg
agtgagcctgtgcacctgaaagaaggtgagatgtataaaagagctcagggaagaactcgg
attgggaaaaagaatttcaagaaacggtggttctgcttaacaagcagagagctcacctac
cacaaacagccaggtaaattcattgaacgcaaagatgcaatttatacaattccagtgaaa
aacattcttgctgtagaaaaactggaagagagctctttcaacaagaaaaatatgttccaa
gtaatacatatggagaaaccgctctatgtccaggcaaataattgtgtagaagctaatgaa
tggatagacgtactctgcagggtcagccgatgcaatcagaacaggctcagtttttatcat
ccctctgcgtatctcaatggaaactggctctgctgtctggagaccagtgaaaacgctctg
ggctgcaagccatgtactgcaggtgtccctgcagacatccaaatagatattgatgaagac
agagaaacagaaagaatttattccctttttaccctcagtttacttaagctgcagaaaatg
gaagaggcttgtggaactatagcagtctatcaaggaccacagaaagagcctgatgattat
tctaactttgtaattgaggattctgtaacaacctttaagacaattaagcaaataaaaagc
atcatagagaagctagatgaacctcatgaaaagtataggaagaaaagatcaactagtgca
aaatatgggagcaaggaaaatccaattgtaggaaaaacatcttag

DBGET integrated database retrieval system