KEGG   Felis catus (domestic cat): 101098503
Entry
101098503         CDS       T02385                                 

Gene name
ATXN7L3
Definition
(RefSeq) ataxin-7-like protein 3 isoform X1
  KO
K11363  SAGA-associated factor 11
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    101098503 (ATXN7L3)
   03036 Chromosome and associated proteins [BR:fca03036]
    101098503 (ATXN7L3)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101098503 (ATXN7L3)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     101098503 (ATXN7L3)
    SLIK complex
     101098503 (ATXN7L3)
SSDB
Motif
Pfam: Sgf11 SCA7 FXMRP1_C_core zf-C2HC_2
Other DBs
NCBI-GeneID: 101098503
NCBI-ProteinID: XP_011287557
Ensembl: ENSFCAG00000008027
Position
E1
AA seq 373 aa
MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKD
FEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRI
ANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKLWYLPFQNPNSPRRSKSLKHK
NGFSVCTSASNTLPLLFSSSGELSNSDPFKYNNSTGISYETLGPEELRSLLTTQCGVISE
HTKKMCTRSLRCPQHTDEQRRAVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRLQW
DGSSDLSPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASSLGSNKKKKPKP
PAPPTPSIYDDIN
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaaatggaggaaatgtctttgtctggcctggataacagcaaactagaggccatcgct
caggagatatacgcggacctggtcgaggattcttgtttgggattctgctttgaggtacac
cgggctgtcaagtgtggctacttcttcctggacgacacggaccctgatagcatgaaggat
tttgagatcgtggaccagccggggttggacatctttggacaggttttcaaccagtggaag
agcaaggagtgtgtttgccccaattgcagccgcagcattgccgcctcccgctttgctcca
catctggagaagtgcctgggaatgggccggaacagcagccggatcgccaaccgccggatt
gccaacagcaacaatatgaacaagtcggagagtgaccaagaggataatgacgacatcaat
gacaacgactggtcgtacggctcagagaagaaagccaagaagaggaaatcagacaagcta
tggtatctcccattccagaaccccaattcccctcgaagatccaagtctttaaaacacaaa
aatgggttctctgtctgtacctctgcatcaaacacccttccccttcttttttcttcttca
ggggaacttagcaattcggatccttttaagtataacaactcaactgggatcagctacgag
accctggggccggaggagctgcgtagcctgctcaccacgcaatgtggggtgatttctgaa
cacaccaagaagatgtgcacaaggtccctgcgctgcccccagcacacagatgagcagcgg
cgagccgtgcggatttacttcctcggaccctcagccgtccttccagaggtcgagagttcc
ctggataacgacagctttgacatgactgacagccaggccctgatcagccggcttcagtgg
gacggctcctctgatctctcaccctctgattcgggctcctccaagacgagtgagaatcag
ggatggggtctaggtaccaacagctcagagtcacggaaaaccaagaaaaagaaatcccat
ctgagcctggtagggactgcctccagcctaggctccaacaagaagaagaagccaaagcca
ccggcacccccaacgcccagcatctacgatgacatcaactga

DBGET integrated database retrieval system