KEGG   Felis catus (domestic cat): 101098622Help
Entry
101098622         CDS       T02385                                 

Gene name
MAP4K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 3 isoform X1
  KO
K04406  mitogen-activated protein kinase kinase kinase kinase 3 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101098622 (MAP4K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101098622 (MAP4K3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101098622 (MAP4K3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE20 family
   101098622 (MAP4K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like QVR
Motif
Other DBs
NCBI-GeneID: 101098622
NCBI-ProteinID: XP_023107702
Ensembl: ENSFCAG00000030212
Position
A3
AA seq 894 aa AA seqDB search
MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQ
EIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRET
LQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAP
EVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKM
KWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHDF
DDDDPEPLVAVPHRIHSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELPDSDGFLD
SSEEIYYTARSNLDLQLEYGQGHQGSYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDD
ESKHSTMKAKVPPPLPPKPKSIFIPQETHSTEDDNQGTIKRCPMSESPAKPSQVPPRPPP
PRLPPQKPIALGNGMSSFQLNGERDGSLYQQQNEHRGTNPSRKEKKDVPKPISNGLPPTP
KVHMGACFSKVFNGCPLKIHCATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLF
PRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKF
AVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPC
PLRVFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDSPQTSVTHVT
QLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQG
RSFRSNEVTQEISDNTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgggttcgatttgtcccgccggaacccgcaggaggacttcgagctgattcag
cgcatcggcagcggcacctacggcgacgtctacaaggcacggaatgttaacactggtgaa
ttggcagcaattaaagtaataaaactggaaccaggagaagattttgcagttgtacagcaa
gaaattattatgatgaaagactgtaaacacccaaatattgttgcttattttggaagctat
ctcaggcgagataaactttggatatgcatggagttttgtggaggtggttctttacaggat
atttatcatgtaacgggacctctgtcagaactgcaaattgcatatgttagcagagaaaca
ctacagggattatactatcttcacagtaaaggaaaaatgcacagagatataaagggagct
aacattctgttaacggataatggtcatgtaaaattggctgattttggagtatctgcacag
attacagctacaattgccaaacggaaatctttcattggtacaccatattggatggctcca
gaagtcgcagctgttgagaggaaagggggttacaaccagctctgtgacctctgggctgtg
ggaatcactgccatagaacttgcggagcttcagccgcctatgttcgacttgcacccaatg
agagcgttatttctaatgacaaaaagtaattttcagcctcctaaactaaaagataaaatg
aaatggtcaaatagttttcatcatttcgtaaaaatggcactcaccaaaaatccaaagaaa
agacctactgctgagaagttactacagcacccttttgtcacacaacctttgacacggtct
ttggcaatcgaactgttagataaagtgaataatccagatcattccacctaccatgatttt
gatgatgatgatcctgagcctcttgttgctgtaccacatagaattcactcaacgagtaga
aatgtaagagaagaaaaaacccgctcggagataaactttggccaagtaaaatttgatcca
cccttaaggaaggagacagaaccacatcatgaacttcccgacagtgatggttttttggac
agttcagaagaaatatactacactgcaagatctaatctggatctacaactagaatatgga
caaggacaccaaggtagttactttttgggtgcaaacaagagtcttctgaagtctgttgaa
gaagaattacatcagcgagggcacgtggcacatttagaagatgatgaaggggatgatgat
gaatccaagcattcaaccatgaaagcaaaagttccacctcctttgccaccaaagcctaag
tccatattcataccacaggaaactcattctactgaggatgataatcaaggaaccatcaag
agatgtcctatgtcagagagcccagcaaaaccatcccaagttccacccagaccaccacct
cccagattacctccacaaaagccaattgctttaggaaatggaatgagctccttccagtta
aatggtgaacgagatggttcattatatcaacaacagaatgaacatagaggcacaaaccct
tcaaggaaagaaaagaaagatgtaccaaagcctattagtaacggtctacccccaacacct
aaagtgcatatgggtgcatgtttttcgaaggtttttaatggatgtcccttgaaaattcac
tgtgcaacatcatggataaacccagatacaagagatcagtacttgatatttggtgctgaa
gaaggaatttatactttgaatcttaatgaacttcatgaaacatcgatggaacagctattc
ccccgaaggtgtacatggttatatgtgatgaacaattgcttactgtcaatatctggtaaa
gcttctcagctttattcccataatttaccagggctttttgattatgcaagacagatgcaa
aagttacctgttgctattccagcacacaaactccctgaccgaatactgccaaggaaattt
gctgtatcagcaaaaatccctgaaaccaagtggtgtcagaaatgttgtgttgtgcgaaat
ccttacacaggccataagtacctatgtggggcgcttcagactagcattgttctattagaa
tgggttgaaccaatgcagaaatttatgttaattaagcacatagattttcctataccttgt
ccgcttcgagtgttcgaaatgctggtagttcccgaacaggagtaccctctcgtctgtgtt
ggcgtcagcagagggagagacttcaaccaggtggttcgatttgaaactgtcaacccaaat
tctacctcttcgtggtttacagagtcagatagcccacagacaagtgttactcacgtaacc
caattggagagagataccattcttgtatgcttggattgttgtataaaaatagtaaatctc
caaggaagattaaaatctagcagaaaattatcatctgagctcacctttgatttccagatt
gaatcaatagtttgcctacaagacagtgtgctagctttctggaaacatggaatgcaaggt
agaagttttagatctaatgaggtaacacaagaaatttcagataacacaagaatttttagg
ctgcttggatccgacagggtcgtggttttggaaagtaggccaactgataaccccacagca
aatagcaatttatacatcctggcgggtcatgaaaacagttactga

DBGET integrated database retrieval system