KEGG   Felis catus (domestic cat): 101098714Help
Entry
101098714         CDS       T02385                                 

Gene name
TAB2
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101098714 (TAB2)
   04064 NF-kappa B signaling pathway
    101098714 (TAB2)
   04668 TNF signaling pathway
    101098714 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101098714 (TAB2)
   04621 NOD-like receptor signaling pathway
    101098714 (TAB2)
   04657 IL-17 signaling pathway
    101098714 (TAB2)
  09158 Development
   04380 Osteoclast differentiation
    101098714 (TAB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101098714 (TAB2)
   05162 Measles
    101098714 (TAB2)
   05161 Hepatitis B
    101098714 (TAB2)
   05168 Herpes simplex virus 1 infection
    101098714 (TAB2)
   05169 Epstein-Barr virus infection
    101098714 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101098714 (TAB2)
   05140 Leishmaniasis
    101098714 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP DLP_helical DivIC
Motif
Other DBs
NCBI-GeneID: 101098714
NCBI-ProteinID: XP_006932147
Ensembl: ENSFCAG00000011287
UniProt: M3WEU1
Position
B2
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGVSGLRNHMTSLNLDLQSQNVYHHGREGHRVNGSRTLTHSISDGQLPGGPANNE
LFQQEPQTAPAQAPQGFNVFGMSSASGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTARQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTPYPASNPMSHTSAQQPNQQGHQTSHVYMPISSPTTPQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTSSSSSSVNSQTL
NRNQPTVYIAASPPNTDEMMSRSQPKVYISANAAPGDEQIMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSTIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataacaacctggat
gcctgctgtgcagttctctctcaggagagtacaaggtatctttatggtgaaggagacttg
aacttctcggatgactctggagtttctggcctacgcaatcacatgacttctctcaacttg
gacttgcagtcgcagaatgtttaccaccatgggagagaaggacatcgagtgaacggaagc
aggactctgacgcacagcattagtgatggacaacttccaggtggtccggccaataacgag
ctatttcagcaggagccacagacagcaccagctcaagctcctcaaggctttaacgttttt
ggaatgtctagtgcatcgggtgcttcaaattcagcaccgcatcttggatttcacttaggc
agcaaaggaacatctagcctttctcagcagactcccagatttaatcccattatggtgacg
ttagccccaaacatccagactggtcgtaacactcctacatctttgcacatacatggtgta
cctccccctgtactgaacagtccacagggaaattctatctatattaggccttatattacg
actcctggtggtacagctcgacagacacaacagcattctggctgggtatctcagtttaat
cctatgaaccctcaacaagtctatcagccttcacagcctggcccctggactccttatcct
gcatctaatcctatgtcacatacctcagcccagcagccaaaccagcaaggccaccagacc
tctcacgtctacatgcccatcagttcacctactactccacagccaccgaccattcattca
tctgggagctcccagtcttctgcccatagccaatacaacattcagaacatttcgacagga
cctcgaaaaaaccagatcgaaatcaaacttgaacccccacaaagaaacagctcttcaaaa
ttgcgttcctctggacctcgaacctccagcagttcctcttcggtcaacagccagacctta
aatagaaatcagcccactgtttacatagctgccagtcccccaaatactgatgagatgatg
tcccgtagtcaacctaaggtctacatttcggccaatgccgccccaggagatgaacagatc
atgaggaatcagcccaccctcttcatatccacaaactccggagcatctgcggcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcaccaccaccctcccaaaagc
cgagcaataggcaataactccgcaacttctcctcgagtggtggtcactcaacccaataca
aaatatactttcaaaattacagtttctcctaataaaccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaaccttctaaaccatcctgatcattatgtagaaaca
gagaatattcagcacctcacggaccctactttagcacatgtggatagaataagtgaagca
cggaagttgagtatgggatctgatgatgctgcctacactcaagctctgttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ctaaaatctgaggtcaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattccatatcccaaataccttcactcgaagaaatgcagcaattgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaatcccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccaccatcaaaacaccaaagactcaagacaca
gaagatgatgagggggctcagtggaattgtactgcctgtacttttttgaaccatccagcc
ttaatccgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system