KEGG   Felis catus (domestic cat): 101098848Help
Entry
101098848         CDS       T02385                                 

Gene name
SRD5A1
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 1
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101098848 (SRD5A1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101098848 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 101098848
NCBI-ProteinID: XP_023095459
Position
A1
AA seq 255 aa AA seqDB search
MEPAEGSHLDALAYLECALGLLGSVLLKLVRSAYGRYASPRPACRVPARAAWALQELPSL
AVPLWVCARTAAERLRHAPNRVLLAMFLVHYAQRSLIFPLLIRGGKPMPLYTCTLAFTFC
VYNGYLQSRYLSQYAVYADDWVTDPRFLVGFCLWLIGMLINIHSDHILRNLRKPGETGYK
IPRGGLFEYVTAANYFGEVVEWCGYALASWSVQGGAFAAFTFCILVSRAQQHHQWYLEKF
EDYPKFRKIIIPFLL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggagccggccgagggctcccacctggacgcgctcgcctacctggagtgcgcgctgggc
ttgctgggctccgtgctgctgaagctggtgcgctcggcctacgggcgctacgcgtctccg
cgccccgcctgccgcgtgccggcgcgggccgcctgggcgctgcaggagctgccctcgctg
gccgtgccgctctgggtgtgcgcccgcacggctgccgagcgcctccgccacgcgcccaac
cgcgtcctcctggccatgttcctcgtccactacgcgcaacggtccttgattttcccgctt
ctgatccgaggaggaaagccgatgcccctgtacacgtgtacgttggcgttcacgttctgt
gtctataacggctacttgcagagcagatatttgagtcagtatgcggtatatgcggatgac
tgggtcactgatccccgatttctagtaggtttctgcttatggttaataggcatgctgata
aacatccattccgaccatatcctgaggaatctccggaaaccaggggagactggatataaa
ataccaaggggaggcttatttgaatacgtaacagcagccaactactttggggaggtggtc
gagtggtgtggctacgccctggccagctggtccgttcaaggcggggccttcgccgccttt
accttctgtattttagtctcccgagcacagcagcaccaccagtggtaccttgagaaattt
gaagattatccaaagttcaggaaaattataatcccgtttttgttgtaa

DBGET integrated database retrieval system