KEGG   Felis catus (domestic cat): 101099503Help
Entry
101099503         CDS       T02385                                 

Gene name
CNDP1
Definition
(RefSeq) beta-Ala-His dipeptidase
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00330  Arginine and proline metabolism
fca00340  Histidine metabolism
fca00410  beta-Alanine metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101099503 (CNDP1)
   00340 Histidine metabolism
    101099503 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101099503 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101099503 (CNDP1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     101099503 (CNDP1)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M20
   101099503 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 101099503
NCBI-ProteinID: XP_006939039
Ensembl: ENSFCAG00000008275
Position
D3
AA seq 485 aa AA seqDB search
MFSPSPPPSGLLERVFQFIDLHQNEFVQILKEWVAVESDSVQPVPHLRQELFRMMALAAD
KLRCLGASVDSVDTGFQQLPDGQTLPIPPIILAELGNDPKKPTVCFYGHLDVQPARQEDG
WLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEEDLPVNIKFIIEGMEEAGS
VALEELVRKEKDRFFSSVDYVVISDNLWINQGKPALTYGTRGNSYFRVEVKCRDQDFHSG
TFGGILHEPMADLVALLGSLVDSSGHILIPGIYDQVAPLTEEERKMYKAIDLDLEEYRHS
SHVKKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGAKTVIPGRVIGKFSIRLVPHMNT
SVVEKQVKQHLEHIFSKRNSSNQMTVSMTLGLQPWMANIKDNQYLAAKRAIKTVFGTEPD
MTRDGSTIPIARIFQDIIQKSVMMLPLGAVDDGEHSQNEKINRWNYIEGSKLFAAFFLEM
AKLHL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccgtccccaccaccctccgggctgttggagagggtcttccagttcattgat
ctccaccagaatgagtttgtacagatacttaaggagtgggtggccgtagagagtgactcc
gttcagcccgtgccccacctcaggcaagagctcttccgaatgatggccctggctgcagac
aagcttcggtgcctgggtgccagcgtggactccgtggacacgggctttcagcagctgcct
gatggtcagactctcccgatacctcccatcatcctggccgaactgggaaatgacccaaaa
aagcccaccgtgtgcttctatggccacttggacgtgcagcctgctagacaggaagatggg
tggctcacagacccttacacgctgacggaagtggatggaaaactttatggtcgtggcgca
acagacaacaagggccccgttttagcgtggattaatgctgtgagcgccttcagagccctg
gaagaagatctccccgtgaatatcaaattcatcatcgaaggcatggaagaagccggttct
gttgccctggaggaactggtcagaaaagaaaaggaccggttcttttccagtgtagactac
gtcgtgatttcagataacctgtggatcaaccaggggaagccggccctcacctacggcacg
agagggaacagctacttcagggtggaggtgaaatgccgagatcaagattttcattcagga
acctttggtggcatcctccatgagccaatggctgatttggttgcacttcttggcagcctg
gtggactcatctggtcatattctgatccctggaatctatgaccaagtggctcctcttacg
gaagaagagagaaaaatgtacaaagccattgatttggacctggaggaataccggcatagc
agccacgttaagaaatttctgtttgacaccaaggaggaaattctaatgcacctatggagg
tacccatcgctgtcaatccacgggatcgagggtgcatttgatgagcctggagctaaaacc
gtcatccctggccgagttatcggaaaattttcaatccgtctggtccctcacatgaatacg
tctgtggtggaaaaacaggtgaagcagcatcttgaacatatattctccaaaagaaatagt
tccaaccagatgactgtttctatgacactgggactacagccgtggatggcaaatattaaa
gataatcagtatcttgcggccaaaagagccatcaaaacagtatttggaacagagccagac
atgacccgggatggctcaaccataccgattgccagaatattccaggatatcatccaaaag
agtgtgatgatgctcccgctgggtgctgttgatgatggggaacactctcagaatgagaaa
atcaacaggtggaactacatagaaggatccaagttatttgctgcctttttcctagagatg
gctaagcttcatttgtaa

DBGET integrated database retrieval system