KEGG   Felis catus (domestic cat): 101099613Help
Entry
101099613         CDS       T02385                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03460  Fanconi anemia pathway
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101099613 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099613 (POLK)
   05202 Transcriptional misregulation in cancer
    101099613 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101099613 (POLK)
   05212 Pancreatic cancer
    101099613 (POLK)
   05225 Hepatocellular carcinoma
    101099613 (POLK)
   05226 Gastric cancer
    101099613 (POLK)
   05214 Glioma
    101099613 (POLK)
   05216 Thyroid cancer
    101099613 (POLK)
   05220 Chronic myeloid leukemia
    101099613 (POLK)
   05217 Basal cell carcinoma
    101099613 (POLK)
   05218 Melanoma
    101099613 (POLK)
   05213 Endometrial cancer
    101099613 (POLK)
   05224 Breast cancer
    101099613 (POLK)
   05222 Small cell lung cancer
    101099613 (POLK)
   05223 Non-small cell lung cancer
    101099613 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101099613 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fca03400]
    101099613 (POLK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101099613 (POLK)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    101099613 (POLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone MMACHC Cys_rich_CPCC
Motif
Other DBs
NCBI-GeneID: 101099613
NCBI-ProteinID: XP_006927854
Ensembl: ENSFCAG00000001614
UniProt: M3VWZ0
Position
A1
AA seq 863 aa AA seqDB search
MHSTKEKNDNNKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATRGSKFYVNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRDLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMMMLSTSNYYARRFGVRAAMPGFIAKRLCPQLTIVPPNFDKYQAVSRE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTGNSLENDKPGEEVNK
VSEQERSIPPLLFNDIPPDLHPQGNPFQANSEEQNNPQILQNAIVFGTSAEEAVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPDREAVMDFIKDLPIRKVSGIGKV
TEKMLKALGVITCTELYQQRALLSLLFSETSWHHFLHISLGLGSTLLARDGDRKSMSVER
TFSEMSKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKDLLRTEIDADFPHPLRLRLMGVRLSSFPNEEDKKQQQRSIIGFLQAGNQAL
SATGHMLEKTDKDQFLKPLEMSQKKSFFDKKRSERKWSQQDTFKCEAVDTQSLQTSDSFQ
VLKKMNENLETSENSNKSQIFICPVCFREHGSISLEAFNKHVDACLNGPSINEDRKMFSC
SHASSTEVNRKENVHHSFSLREKQDYETHQKHSGINSVDCAELVETKGNPPKAESVGALS
DKHSKEECAVFPRESFNTEQHYQNSFSTVLLEDTGSSQQESPQPYLPEVIITQALVCPIC
NLEQKTSDLTLFNMHVDICLNKGIIQELRKDSLANQPTKSTKSTDTSGQVQKTATKTKRP
GMYSSSKKVKPNSTRHTLDIFFK
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcaccaaggagaagaatgacaacaacaaagatgaccttctgcttaggatggga
cttaatgataataaagctggaatggaaggattagataaagagaagattaataagattata
atggaagccacaagggggtccaaattttatgtaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccaacagctaagg
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgggatctgaac
aatactatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaactgaaggataaacccattgctgtaggatcaatgatgatgttgtctacctcgaat
tactacgcaaggaggtttggtgttcgtgcagctatgccaggatttattgctaaaagactc
tgcccacaactcactatagtgcccccaaactttgacaaataccaagctgtgagtagagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcctgaggacaaaaggaag
tatttcatcaaaacagggaactctctagaaaatgataaacctggagaagaagtgaataaa
gtgagtgagcaggagcgatccatccctccactactctttaatgacattcctcctgatttg
cacccccaaggaaatcctttccaagcaaactctgaagagcaaaataatcctcaaatactc
caaaatgcgattgtttttggaacatcagccgaggaagccgtaaaggaaattcgtttcaga
attgagcaaaaaacaacattgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattctccccgatagagaa
gctgtgatggatttcatcaaggacttacccattagaaaggtgtctggcataggaaaagtt
acagagaaaatgttaaaggcccttggagttattacttgtacagaactctaccaacagagg
gcattactttctcttcttttctctgaaacatcttggcatcatttccttcatatttccctg
ggtctaggttcaacactcctggcaagggatggagataggaaaagcatgagcgttgagagg
acattcagtgagatgagtaaagcagaagaacagtatagcttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaagaaggattaaagggtagaactgttaccattaaactg
aagaatgtaaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgctattgctaaagacttgctaagaacagaaattgatgctgatttt
ccacatcccttgagattaagacttatgggtgtacggttatctagttttcccaatgaagaa
gacaagaaacagcaacaaaggagcattattggctttttacaggctggaaaccaagctctg
tcagctactgggcatatgctagagaaaactgacaaagatcagtttctaaaacctctagaa
atgtctcaaaagaagagcttctttgataaaaagcgatcagaaaggaaatggagccaacaa
gacacatttaagtgtgaagctgtggatacacaaagtttacagacatcagattcattccaa
gttttaaagaagatgaacgagaatttagaaacatcagagaattcaaataagtctcagata
tttatctgtcccgtttgctttagggagcatggaagcatcagtctggaagcctttaataaa
catgtagatgcctgtcttaatggaccttcaattaatgaagaccgtaaaatgttctcatgc
tcacatgcttcctctacagaagttaacaggaaagaaaatgtacatcattctttttcactc
cgtgagaagcaggattatgaaacccatcagaagcattcaggaatcaattcagtagattgt
gcagagctagtagagactaaaggtaacccacctaaagcagaaagtgtaggtgctttaagt
gataagcacagcaaagaggaatgtgctgtttttccaagagaatcgtttaatactgagcaa
cattatcagaattctttctctactgttttactggaagatacggggtcaagtcagcaagaa
tccccccagccttatttacctgaagtgataataacccaagctctagtttgtcctatttgt
aacctggaacaaaagacttcagatcttaccctgttcaatatgcatgtggatatatgctta
aataaaggtattatccaggaactgagaaaggatagtctagctaatcaacccacaaaaagc
accaaaagtactgatacctcaggccaagtacaaaagactgcaacaaaaacaaaaaggcca
ggaatgtactcatcgtcaaagaaagtaaaaccaaacagtaccagacacactcttgatata
ttttttaaatga

DBGET integrated database retrieval system