KEGG   Felis catus (domestic cat): 101099750Help
Entry
101099750         CDS       T02385                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04140  Autophagy - animal
fca04144  Endocytosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04722  Neurotrophin signaling pathway
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101099750 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101099750 (TRAF6)
   04064 NF-kappa B signaling pathway
    101099750 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101099750 (TRAF6)
   04140 Autophagy - animal
    101099750 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101099750 (TRAF6)
   04621 NOD-like receptor signaling pathway
    101099750 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    101099750 (TRAF6)
   04657 IL-17 signaling pathway
    101099750 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101099750 (TRAF6)
  09158 Development
   04380 Osteoclast differentiation
    101099750 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099750 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101099750 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101099750 (TRAF6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101099750 (TRAF6)
   05152 Tuberculosis
    101099750 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101099750 (TRAF6)
   05162 Measles
    101099750 (TRAF6)
   05161 Hepatitis B
    101099750 (TRAF6)
   05160 Hepatitis C
    101099750 (TRAF6)
   05168 Herpes simplex virus 1 infection
    101099750 (TRAF6)
   05169 Epstein-Barr virus infection
    101099750 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101099750 (TRAF6)
   05140 Leishmaniasis
    101099750 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    101099750 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101099750 (TRAF6)
   04121 Ubiquitin system [BR:fca04121]
    101099750 (TRAF6)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101099750 (TRAF6)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101099750 (TRAF6)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101099750 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Med21 U-box UPF0242 Spc29 DUF4455 Tropomyosin_1 SlyX Laminin_I DUF16 Sina EzrA CENP-F_leu_zip
Motif
Other DBs
NCBI-GeneID: 101099750
NCBI-ProteinID: XP_011285100
UniProt: A0A2I2U6B5
Position
D1
AA seq 541 aa AA seqDB search
MSLLNCENSCGSSQSESDCCAAMASSCSAAAKDDSVSGTASTGNLSNSFMEETQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCRACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILK
ECPRRQVSCVNCAALMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALPPVPQCDMPPYDSSSA
SRVSTGCHPEVQNFQETIQQLEGRLVRQDHQIRELIAKMETQSMYVSELKQTIRTLEDKV
VEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgcggatccagccagtctgagagtgactgctgt
gccgccatggccagctcctgtagcgctgcggcgaaagatgacagtgtgagtggaaccgcc
agcacggggaacctctccaactctttcatggaagagacccaggggtatgacgtggagttt
gacccgcccctggagagcaagtatgagtgccccatctgcctgatggctctccgggaggca
gtgcagacaccgtgcggccacaggttctgcagagcttgcatcatcaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcaccaagcacattgtgaatttgctcttatg
aattgtcctcagtgccagcgtcccttccaaaaatgccaacttaatattcacattctcaag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgcattgatggcatttgaagat
aaagagatccacgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcattacgacctggactgtcctacagccccaatt
ccatgcacattcagtacttttggttgccatgtaaagatgcagaggaatcacttggcacgc
cacctgcaagagaatacccagtcgcacatgagaatgttggcccaggctgttcagagttta
agccttgcgttacctcctgtacctcagtgtgatatgcctccatacgattcttcctctgcg
tcccgggtttccactgggtgtcacccagaggtccagaatttccaagaaaccattcagcag
ttagagggtcgccttgtaagacaagaccatcaaatccgagagctaattgctaaaatggaa
actcagagcatgtacgtaagtgagctcaaacaaacgattcgaacccttgaggacaaagtt
gttgaaatagaagcacagcagtgcaatgggatttacatctggaagattggcaactttggg
atgcatttgaaatctcaagaagaggagaaacctgttgtcattcatagccctggattctac
acaggcaaacccgggtacaaactgtgcatgcgcctgcaccttcagttaccgtcggctcag
cgctgtgctaattacatatccctctttgtgcacacaatgcaaggagagtatgacagccac
ctcccttggcccttccagggtacaatccgccttacgattcttgatcagtctgaggcacct
ataaggcaaaaccatgaagagatcatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgacttttatgcatctggaagcc
ctgagacagagaaccttcattaaggacgatactttattagtgcgctgtgaggtctctacc
cgctttgacatgggtagtctccggagggagggttttcagccacgaagtactgattcaggg
atgtag

DBGET integrated database retrieval system