KEGG   Felis catus (domestic cat): 101100227Help
Entry
101100227         CDS       T02385                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04137  Mitophagy - animal
fca04350  TGF-beta signaling pathway
fca04915  Estrogen signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05016  Huntington disease
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05224  Breast cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101100227 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101100227 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101100227 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    101100227 (SP1)
   04927 Cortisol synthesis and secretion
    101100227 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100227 (SP1)
   05202 Transcriptional misregulation in cancer
    101100227 (SP1)
   05231 Choline metabolism in cancer
    101100227 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    101100227 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101100227 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101100227 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101100227 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101100227 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101100227 (SP1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101100227 (SP1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 ubiquitous factors
    101100227 (SP1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    101100227 (SP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 101100227
NCBI-ProteinID: XP_023112879
Ensembl: ENSFCAG00000030741
Position
B4
AA seq 786 aa AA seqDB search
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSGGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
KEQSGSSTNGSNGSESSKNRTVSGGQYVVAATSNLQNQQVLTGLPGVMPNIQYQVIPQFQ
TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPAT
SGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSAGTNSQGQTPQRVS
GLQGSDALNIQQNQTSGGSLQASQQKEGEQNQQTQQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPTGTVTVNAAQLSSMPGLQTINLSALGA
SGIQVHQLPSLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVSL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgaaaaagga
gttggtggaaataatgggggcaatggtaatggtggtggtgccttttctcaggctcgaagc
agcagcacaggcagtagcagcagtggaggaggaggagggcaggaatcccagccatcccct
ttggctctgctggcagcaacttgcagcagaattgagtcacccaatgaaaacagcaacaac
tcccagggcccaagccagtcagggggcacaggtgagcttgacctcacagccacacaactc
tcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacctca
aaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaatcgc
acagtctctggtgggcagtatgttgtggctgccacgtccaacttacagaaccagcaagtc
ctgacaggattacctggagtgatgcctaatattcagtatcaagtaatcccacagttccag
accgttgatgggcaacagctgcaattcgctgccactggggcccaagtgcagcaggatggt
tctggtcaaatacagatcataccaggtgcaaaccaacagatcatcacaaatcgaggaagt
ggaggcaacatcattgctgctatgccaaatctactccagcaggctgtcccccttcaaggc
ctggctaataatgtactctcaggacagactcagtatgtgaccaatgtaccagtggcccta
aatgggaatatcaccttgctacctgtcaacagcgtttctgcagctaccttgactcctagc
tctcaggcagtcactatcagcagctctgggtcccaagagagtggttcacagcccgccacc
tcagggactgccatcagttctgccagtttggtatcatcacaagccagttccagctccttt
ttcaccaatgccaatagctactcaacaactactaccaccagcaacatgggaattatgaac
tttaccaccagcggatcagcagggaccaactctcaagggcagacaccccagagggtcagt
gggctacaggggtctgatgctctaaacatccaacagaaccagacatctggaggctctctg
caagcaagtcaacaaaaagagggagagcagaaccagcagacacagcaacagcagcaaatt
cttatccagcctcagcttgttcaagggggacaggctctccaggccctccaagcagcacca
ttgtcagggcagacctttacaactcaagctatctcccaggaaaccctccagaatctccag
cttcaggctgttccaaactctggccccatcatcatccggacaccaacagtggggcccaat
ggacaggtcagttggcagactcttcagctgcagaatcttcaagttcagaacccacaggcc
cagacaatcaccttggccccaatgcagggcgtttccttggggcagacgagcagcagcaat
accacccttacacccattgcctcagctgcctccatccctaccggcacagtcactgtgaat
gctgctcagctctcctccatgcctggcctccagaccattaacctcagtgcattgggtgct
tcaggaatccaggtgcaccagcttccaagcctgcccttggctatagcaaatgccccaggt
gatcatggagctcagcttggcctccacggagctggtggtgatggaatacatgatgacaca
gcaggtggagaagaaggagaaaacagcccagatccgcaaccccaggctggtcggaggacc
cggcgtgaagcatgcacctgcccctattgtaaagatagtgaaggaaggggctctggggat
cctggcaaaaagaaacagcacatttgccacatccaaggctgtgggaaagtatatggcaag
acctcacacctacgggcacacttgcgctggcatacaggcgagaggccattcatgtgtact
tggtcatactgtgggaagcgctttacacgttcagatgagctacagagacacaaacgcaca
cacacaggtgagaagaaatttgcctgccctgagtgtcccaagcgcttcatgaggagtgac
cacctgtcaaagcatatcaagacccaccagaataagaaaggaggcccaggtgtatccctg
agtgtgggcactttgcccctggacagtggggcaggttcagaaggcagtggcactgccacc
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggtatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcggatctgcagtccattaat
atcagtggcaatggcttctga

DBGET integrated database retrieval system