KEGG   Felis catus (domestic cat): 101100276
Entry
101100276         CDS       T02385                                 

Gene name
MYOG
Definition
(RefSeq) myogenin
  KO
K18483  myogenic factor 4 (myogenin)
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101100276 (MYOG)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    101100276 (MYOG)
SSDB
Motif
Pfam: Basic HLH DUF3080 DUF5648
Other DBs
NCBI-GeneID: 101100276
NCBI-ProteinID: XP_003999430
Ensembl: ENSFCAG00000013108
UniProt: A0A2I2U9I7
Position
F1
AA seq 249 aa
MAPSSWREGLQELGGQWQEQVSSDPMELYETSPYFYQEPHFYDGENYLPVHLQAFEPPGY
ERTELSLSPEARGPLEDKGLGTPEHCLGQCLPWACKVCKRKSVSVDRRRAATLREKRRLK
KVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQ
PGVPSECSSHSASCSPEWGSTLEFGPNTGDHLLTADPTDAHNLHSLTSIVDSITVEDVSV
AFPDETMPN
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcacccagcagttggcgtgaggggctgcaggagcttgggggccagtggcaggaacaa
gtctcttccgaccccatggagctatatgagacatccccctacttctaccaggaaccccac
ttctatgacggggagaactacctgcccgtccacctccaggccttcgagccgccaggctac
gagcggactgagctcagcctgagccctgaggcccgagggcccctcgaagacaaggggctg
gggacccccgagcactgcctgggccagtgcctgccgtgggcctgcaaggtgtgtaagagg
aagtcggtgtccgtggaccggcggcgtgcggccacactgagggagaagcgcaggctcaag
aaggtcaatgaggcctttgaggctctgaagaggagcaccctgctcaaccccaaccagcgg
ctgcccaaggtggagatcctgcgcagcgccatccagtacatcgagcgcctacaggccctg
ctcagctccctcaaccaggaagagcgtgacctccggtaccggggcgggggcgggccccag
ccaggggtgcccagtgaatgcagctcccacagcgcctcctgcagtccagagtggggcagc
acattggagtttggtcccaacacaggggatcacctgctcacggccgaccccacggacgcc
cacaacctgcactctctcacctccattgtggacagcatcacagtggaagacgtctctgtg
gccttcccagatgaaaccatgcccaactga

DBGET integrated database retrieval system