KEGG   Felis catus (domestic cat): 101100378Help
Entry
101100378         CDS       T02385                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X3
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04137  Mitophagy - animal
fca04144  Endocytosis
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04540  Gap junction
fca04611  Platelet activation
fca04625  C-type lectin receptor signaling pathway
fca04727  GABAergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05219  Bladder cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101100378 (SRC)
   04012 ErbB signaling pathway
    101100378 (SRC)
   04370 VEGF signaling pathway
    101100378 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101100378 (SRC)
   04137 Mitophagy - animal
    101100378 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100378 (SRC)
   04520 Adherens junction
    101100378 (SRC)
   04530 Tight junction
    101100378 (SRC)
   04540 Gap junction
    101100378 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101100378 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101100378 (SRC)
   04625 C-type lectin receptor signaling pathway
    101100378 (SRC)
   04062 Chemokine signaling pathway
    101100378 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101100378 (SRC)
   04915 Estrogen signaling pathway
    101100378 (SRC)
   04917 Prolactin signaling pathway
    101100378 (SRC)
   04921 Oxytocin signaling pathway
    101100378 (SRC)
   04926 Relaxin signaling pathway
    101100378 (SRC)
   04919 Thyroid hormone signaling pathway
    101100378 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    101100378 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101100378 (SRC)
  09158 Development
   04360 Axon guidance
    101100378 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101100378 (SRC)
   05203 Viral carcinogenesis
    101100378 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    101100378 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101100378 (SRC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101100378 (SRC)
   05100 Bacterial invasion of epithelial cells
    101100378 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101100378 (SRC)
   05168 Herpes simplex virus 1 infection
    101100378 (SRC)
   05163 Human cytomegalovirus infection
    101100378 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101100378 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101100378 (SRC)
   01522 Endocrine resistance
    101100378 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101100378 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100378 (SRC)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101100378 (SRC)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  SRC family
   101100378 (SRC)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101100378 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101100378 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101100378 (SRC)
  Macropinocytosis
   Kinases
    101100378 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 hSH3
Motif
Other DBs
NCBI-GeneID: 101100378
NCBI-ProteinID: XP_003983533
Ensembl: ENSFCAG00000006991
Position
A3
AA seq 536 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccaacggcgtcgcagcctggagcct
gctgagaacacccacggtggtggtgggggtgccttccccacctcacagacacccagcaag
ccagcctccgctgatggccaccgaggccccagtacggccttcccctctgccgctgctgag
cccaagctgtttgggggcttcaactcctcggacacagtcacctccccgcagagggcgggg
ccgctggcgggtggagtgaccacctttgtggccctctatgactatgagtctcggacagag
actgacctgtccttcaagaaaggggagcggctccagattgtcaacaacacagagggtgac
tggtggctggcccactcactcagcacaggacagacgggctacatccccagcaactatgtg
gcgccctctgactctatccaggccgaagagtggtactttggcaagatcaccagacgggag
tcagagaggttactgctcaatgcggaaaacccaagagggaccttcctagtgcgagaaagc
gagaccacgaaaggcgcctactgcctctccgtgtccgatttcgacaacgccaagggcctc
aatgtgaagcattacaagatccgcaagctggacagcggtggcttctacatcacctcccgc
acccagttcaacagtctgcagcagctggtggcctactactccaaacatgccgacggcctc
tgccaccgcctcaccaccgtgtgccccacgtccaagccacagactcagggcctggccaaa
gacgcctgggagatcccccgggagtccctgcggctggaggtcaagctgggccagggctgt
ttcggagaggtgtggatggggacctggaacggaaccaccagggtggccatcaaaaccctg
aagccaggcacaatgtctccagaggcctttctgcaggaggcccaggtcatgaagaaacta
aggcacgagaaattggtgcagctgtatgccgtggtgtctgaggagcccatctacattgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgccacagctggtggacatggctgctcagatcgcctcgggcatggcctacgtg
gagcggatgaactacgtgcaccgggacctccgtgctgccaacattctggttggagagaac
ctcgtgtgcaaagtggccgacttcgggctggctcggctcatcgaagacaatgaatacacc
gcccggcaaggtgccaaattccccatcaagtggacagctccagaagcggccctgtatggc
cggttcaccatcaagtcagatgtgtggtcctttgggatcctgctgacggagctcacaaca
aagggacgggtgccctaccctgggatggtcaaccgtgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgcctgagtgtcccgagtccctgcatgacctcatgtgccag
tgctggcggaaggaaccggaagagcggcccaccttcgagtacctgcaggccttcctagag
gactacttcacgtccaccgagccccagtaccagcctggagagaacctatag

DBGET integrated database retrieval system