KEGG   Felis catus (domestic cat): 101100541Help
Entry
101100541         CDS       T02385                                 

Gene name
ACP5
Definition
(RefSeq) tartrate-resistant acid phosphatase type 5
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00740  Riboflavin metabolism
fca01100  Metabolic pathways
fca04142  Lysosome
fca04380  Osteoclast differentiation
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    101100541 (ACP5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101100541 (ACP5)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101100541 (ACP5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101100541 (ACP5)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     101100541 (ACP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos Metallophos_2 PhoD
Motif
Other DBs
NCBI-GeneID: 101100541
NCBI-ProteinID: XP_003981942
Ensembl: ENSFCAG00000030665
UniProt: A0A2I2V0R4
Position
A2
AA seq 335 aa AA seqDB search
MDTQTILLILQASLVLPLADGANPVLRFVAVGDWGGVPNAPFYTAREMANAKEIARTVQI
LGTDFILSLGDNFYFTGVQDANDKRFRETFEDVFSASSLRNVPWYVLAGNHDHLGNVSAQ
IAYSRISQRWNFPSPYYRLRFKVPRSNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDAAL
ARTQLSWLKKQLAAAKEDYVLVAGHYPVWSIAEHGPTRCLVKQLMPLLATYKVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSRKHMRKVPNGYLRFHYGAEDSLGGFAYVEISPK
EMSVTYIEASGKSLFKTRLPRRARPEHPRVRHSRA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacacacagactatactgctcatcttgcaagcctcactggtgctccccctggctgac
ggggccaacccagtcctgcgctttgtggctgtgggtgactggggaggagtccccaatgcc
ccgttctacacagcccgggaaatggccaatgccaaggagattgccaggaccgtgcagatc
ctaggcacagacttcatcctgtccctgggggacaatttctacttcactggcgtgcaggac
gccaacgacaagaggtttcgggagaccttcgaggatgtgttctcggcctcctccctccgc
aacgtgccctggtatgtgctggctggcaaccacgaccacctggggaacgtctccgcgcag
atcgcctactccaggatctctcagcgctggaacttccccagcccttactaccgactgcgc
ttcaaagtcccacggtccaatgtgtctgtggccatcttcatgctggacacggtgacgctg
tgcggcaactcggacgacttcctcagccagcagcccgagaggccccgtgacgcggcgctg
gcccgcacgcagctgtcctggctcaagaagcagctggcggcggccaaggaggactacgtg
ctggtggccggccactaccccgtgtggtccatcgccgagcacgggcccacccgctgcctg
gtcaagcagctgatgccgctgctggccacatacaaggtcaccgcctacctgtgcggccat
gaccacaacctgcagtacctccaggacgagaacggcgtgggctacgtgctgagcggggcc
ggaaacttcatggacccctcgaggaagcatatgcgcaaggtccccaacggctacctgcgc
ttccactatggggccgaggactcgctggggggctttgcctacgtggagatcagccccaaa
gagatgagcgtcacttacatcgaagcctcgggcaagtccctcttcaagaccagactgccg
aggcgggccaggcccgagcacccacgcgtgcgccactctagggcctga

DBGET integrated database retrieval system