KEGG   Felis catus (domestic cat): 101100575Help
Entry
101100575         CDS       T02385                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04270  Vascular smooth muscle contraction
fca04714  Thermogenesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101100575 (NPPA)
   04024 cAMP signaling pathway
    101100575 (NPPA)
   04022 cGMP-PKG signaling pathway
    101100575 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101100575 (NPPA)
   04921 Oxytocin signaling pathway
    101100575 (NPPA)
   04924 Renin secretion
    101100575 (NPPA)
   04925 Aldosterone synthesis and secretion
    101100575 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101100575 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    101100575 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    101100575 (NPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 101100575
NCBI-ProteinID: XP_003989547
Ensembl: ENSFCAG00000000070
UniProt: Q9GLD0
Position
C1
AA seq 153 aa AA seqDB search
MGSFSTITASFLLFLACQLLWQTGANPVYGSVSNADLMDFKNLLDHLEDKMPLEDEVVPP
QVLSEQNEEAGAALSPLPEVPPWAGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLA
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgggctccttctccaccatcaccgcgagcttcctcctcttcctggcgtgtcagctcttg
tggcaaacaggagctaacccggtatatggctctgtgtccaacgcagacctgatggatttc
aagaatttgctggaccatttggaggacaagatgcctttagaagatgaagtcgtgccccca
caagtactaagtgagcagaatgaggaagctggggcagctcttagccccctccctgaggtg
cctccctgggctggggaggtcaacccagcccagagagatgggggtgcccttgggcggggc
tcctgggactcctccgatagatctgccctcctgaaaagcaagctgagggcactgctagct
gcccctcggagtctgcggaggtccagctgctttggaggaaggatggacaggattggagct
cagagtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system