KEGG   Felis catus (domestic cat): 101100748Help
Entry
101100748         CDS       T02385                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04136  Autophagy - other
fca04140  Autophagy - animal
fca04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101100748 (ATG16L1)
   04136 Autophagy - other
    101100748 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101100748 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100748 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101100748 (ATG16L1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    101100748 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    101100748 (ATG16L1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    101100748 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 ZapB Fez1 TolB_like
Motif
Other DBs
NCBI-GeneID: 101100748
NCBI-ProteinID: XP_023115587
Ensembl: ENSFCAG00000011322
Position
C1
AA seq 623 aa AA seqDB search
MSSGLRAADFPRWKRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAHKLQAEK
HDVPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECQELRGKLQDLERANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHAEETSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSDAAR
RRSVSSFPVPQDNVDTHPGSSKEVRVPTTAICVFDAHDGEVNAVQFSPGSRLLATGGMDR
RVKLWEVFGDKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTL
TGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMS
GHFDKKIRFWDIRSESIVREMELLGKVTALDLNPERTELLSCSRDDLLKIIDLRVNAVRQ
TFSAPGFKCGSDWTRVVFSPDGGYVAAGSAEGSLYVWSVLSGKVEKVLSKQHGSSINAVA
WSPSGSHVVSVDKGSRAVLWSEY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgccgacttcccccgctggaagcgccacatttcggaggag
ctgaggcggcgggaccggctgcagaggcaggcatttgaagagatcatcctgcagtataac
aagttgctagaaaagtcagatcttcattcagtgctggcccataagctacaagctgaaaag
catgacgtccccaacaggcatgagataagtcctggccacgacggtgcatggaatgatagt
cagctacaagaaatggcccagctgaggattaaacaccaagaagaactgactgaattacac
aagaaacgtggggagttagctcagttggtgattgacctgaataaccaaatgcagcagaag
gatagggagatgcagatgaatgaagcaaaaattgcagagtgcttgcagaccatctctgac
ctggagacggagtgccaagaactgcgtggtaagcttcaggacctcgaaagagccaaccag
accctgaaggatgagtatgatgccctgcagatcacgtttactgctttggaggagaaactg
aggaaaactactgaagagaaccaggagctggtcaccagatggatggccgagaaagcccag
gaagccaaccgcctcaatgcagagaatgagaaggattcaaggcggcggcaagcccggctg
cagaaagagcttgcagaagcggcaaaagaacctctacccgttgaacaggatgatgacatt
gaagtcatcgtggatgaaacctctgatcacgccgaggagacttctcctgtgcgagccatc
agcagagcggccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgagtctccccttttgggacatcactcttctgatgctgccagg
aggcgctctgtctcttcctttccagttccccaggataacgtggatactcatcctggttct
agtaaagaagtgagggtgccaacgaccgccatatgtgtctttgacgctcatgatggggaa
gtcaacgctgtgcagttcagtccaggctcccggttgctggccacaggaggcatggatcgg
agagttaagctttgggaagtgtttggagataaatgtgagttcaagggctccctgtccggc
agtaatgcaggaattacaagcattgaatttgacagtgctggatcttacctcttagcagct
tcaaatgattttgcgagtcgaatctggactgtggatgattatcggttacggcacacgctc
acaggacacagcggcaaagtgctgtctgccaagttcctgctggacaacgcgcgcattgtt
tccggaagtcatgaccggaccctcaagctctgggatctccgcagcaaagtctgcataaag
accgtgtttgcaggatccagctgcaacgatatcgtctgcacagagcagtgtgtgatgagt
ggacacttcgacaagaaaattcgtttctgggacatccgatcggagagcatcgtccgggag
atggagctgctgggcaaggtcactgccctggacttaaacccggagagaaccgaactcctc
agctgctctcgcgatgatcttctaaaaatcatcgatcttcgagtaaacgctgtcagacag
acgtttagcgcccctgggttcaagtgcggctctgattggaccagagttgtgttcagccct
gacggtggttacgtggcagcgggctcggctgagggctccctctacgtctggagcgtgctc
tcggggaaagtggagaaggtcctttcaaagcagcatggctcgtccatcaatgcagtggcg
tggtccccctccggctcccacgtggtcagtgtggacaaaggaagcagagctgtgctgtgg
tcagaatattga

DBGET integrated database retrieval system