KEGG   Felis catus (domestic cat): 101100947Help
Entry
101100947         CDS       T02385                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer's disease
fca05012  Parkinson's disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington's disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05168  Herpes simplex infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101100947
   04215 Apoptosis - multiple species
    101100947
   04115 p53 signaling pathway
    101100947
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101100947
   05210 Colorectal cancer
    101100947
   05222 Small cell lung cancer
    101100947
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101100947
   05012 Parkinson's disease
    101100947
   05014 Amyotrophic lateral sclerosis (ALS)
    101100947
   05016 Huntington's disease
    101100947
  Cardiovascular diseases
   05416 Viral myocarditis
    101100947
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100947
  Infectious diseases
   05134 Legionellosis
    101100947
   05152 Tuberculosis
    101100947
   05164 Influenza A
    101100947
   05161 Hepatitis B
    101100947
   05168 Herpes simplex infection
    101100947
   05163 Human cytomegalovirus infection
    101100947
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101100947
   05145 Toxoplasmosis
    101100947
  Drug resistance
   01524 Platinum drug resistance
    101100947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 101100947
NCBI-ProteinID: XP_011290006
UniProt: M3X7H4
Position
X
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system