KEGG   Felis catus (domestic cat): 101100970Help
Entry
101100970         CDS       T02385                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101100970 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101100970 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101100970 (IRF9)
   04625 C-type lectin receptor signaling pathway
    101100970 (IRF9)
  09158 Development
   04380 Osteoclast differentiation
    101100970 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101100970 (IRF9)
  09172 Infectious disease: viral
   05162 Measles
    101100970 (IRF9)
   05164 Influenza A
    101100970 (IRF9)
   05160 Hepatitis C
    101100970 (IRF9)
   05168 Herpes simplex virus 1 infection
    101100970 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101100970 (IRF9)
   05169 Epstein-Barr virus infection
    101100970 (IRF9)
   05165 Human papillomavirus infection
    101100970 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101100970 (IRF9)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101100970 (IRF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 101100970
NCBI-ProteinID: XP_006932829
Ensembl: ENSFCAG00000018849
Position
B3
AA seq 449 aa AA seqDB search
MKHLANRYCLRRCLGQRPGLSPGTTPREFSSRQQIPEKMASGRARCTRKLRNWVVEQVES
GQFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTEGPAIWKT
RLRCALNKSPEFEEVPENGHRDGAEPYKVYRLLPSGTLPAQPGTQKSPSKRHYSSVSSER
EEDAGTTKNCILSPSLIEDPLKNEEVGASGEAGHSEFGSSSSSNSPEPQEGTDTTEAPFQ
GDQVSLESLPPPDSDYSLLLTFIYGGRVVGEAQVQSLDCRLVAEPSGSQYGMEQVVFPKP
DPREPTQRLLSQIERGVLVASNSRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVEL
FRTTYFCRDLARYFQGLGPPPKFQVTLNFWEESPGPSHTPKSLITVQMEQAFARRLLEET
PEEQAAALSLLQSLGDPPSSSSLCSSYLL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatcttgcaaacagatactgccttcgcagatgcttggggcagagaccgggcctc
tccccaggaaccaccccaagggagttctcttccagacaacagattcctgaaaagatggca
tcgggccgggcacgctgcacccgaaagctgcggaactgggtggtggagcaagtggagagc
gggcagttcccgggggtgtgctgggacgatgcagctaagaccatgttccggattccttgg
aagcatgcaggcaagcaggacttccgggaggaccaggatgccgctttcttcaaggcatgg
gcgatatttaaggggaagtacaaggagggagacacagaaggccctgctatctggaagact
cgtctgcgctgtgctctcaacaagagccccgaatttgaggaggttcctgaaaatggccat
agggatggagctgagccctacaaggtgtatcggctgctgccatcggggaccctccctgcc
cagccagggacccagaaatcaccgtcaaagcgacattacagttctgtgtcctctgagagg
gaagaggatgcgggtaccacaaagaactgcatactcagtccctctttgattgaggacccc
ctcaaaaacgaggaggtgggggccagtggggaagcaggccattcagaatttgggagcagc
agcagcagcaacagccctgagcctcaggaaggtacagacacaacagaagcccctttccaa
ggagatcaggtgtcattggagagtctgcctcctccagactcagactactcgctgctgctt
accttcatctacggtgggcgcgtggtgggcgaagcccaggtgcagagcctggactgccgc
cttgtggctgagccctcaggctcccagtatgggatggagcaggtggtgtttcccaagcct
gacccacgagagcccacccagcgcctgctgagccagatcgagagaggtgtcctagtggcc
agcaactccagaggcctctttgtgcagcgtctctgccccatccccatctcctggaacgcg
ccccaggcgccacccggtccaggcccgcatctgctgcccagcaatgagtgcgtggagctc
ttcagaaccacctacttctgcagagacctggccaggtacttccagggcctgggcccccca
cccaagttccaggtgactctgaacttctgggaggagagccctggccccagccacaccccg
aagagtcttatcacagtgcagatggagcaggcctttgcccgacgtttactggaggaaact
cctgaggagcaggcagccgctctctccctgctgcagagcctgggagacccgccttcctcc
tcttcgctctgttcctcctatctcctttga

DBGET integrated database retrieval system