KEGG   Felis catus (domestic cat): 101101052Help
Entry
101101052         CDS       T02385                                 

Gene name
BST1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 isoform X1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00760  Nicotinate and nicotinamide metabolism
fca01100  Metabolic pathways
fca04970  Salivary secretion
fca04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101101052 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    101101052 (BST1)
   04972 Pancreatic secretion
    101101052 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101101052 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101101052 (BST1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     101101052 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     101101052 (BST1)
CD molecules [BR:fca04090]
 Proteins
  101101052 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Enzymes
  101101052 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 101101052
NCBI-ProteinID: XP_023109057
Ensembl: ENSFCAG00000011131
Position
B1
AA seq 313 aa AA seqDB search
MAALGRASSLLSLLPLLLVPAEGAGGARWRGEGTSPHLRSIFLGRCAEYSSLLSPELRDK
NCTAIWEAFKVVLDKDPCSVFPSDYDLFISLSRHSIPRDKSLFWENNHLLVTSYAENARR
FMPLCDVLYGRIGDFLSWCRQENASGLDYQSCPTSEDCENNPVDSYWKMASMQYSRDSTG
VIHVMLNGSEPKGAYPVKGFFADFEIPYLQKDKITRIEIWVMHEIGRPKVESCGEGSVKI
LEERLEKMGFQYRCINDHLPVKLLMCVDHSTHPDCALNSAVTSTRREAPPLCAEHGASLF
IPFLVVLASVIQP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctggggcgcgcgtcctcgctgctgtcgctgctgccgctgctgctggtgccc
gctgagggcgcagggggcgcgcggtggcgcggggagggcaccagcccgcacctacggagc
atctttctgggccgctgcgcggagtacagctccctgctgagcccggagctgcgggacaag
aactgcacagctatctgggaagcctttaaagtggttctggacaaggatccctgttctgta
tttccctcggactatgacctttttattagcctctccagacactccattcccagggacaag
tccctgttctgggaaaacaaccacctccttgtcactagctatgcggagaatgcccgtcgc
tttatgcctctgtgtgatgttctgtatggcaggattggagattttctgagctggtgtcga
caggaaaatgcctccgggctcgattatcagtcctgccctacgtcagaagattgtgagaac
aaccctgtggattcttactggaaaatggcatctatgcagtattcgagggatagtactggg
gtgatccacgtcatgctgaacggttcagagcccaaaggagcctatcctgttaaaggtttt
tttgcagattttgaaattccctacctccagaaggataaaatcacacgaattgagatctgg
gttatgcatgaaatcgggagaccaaaggtggaatcctgtggagaaggcagtgtgaaaatc
ctggaagagagactggagaaaatgggctttcagtaccgctgtattaatgatcacctacca
gtgaagctcttaatgtgcgtggaccacagcactcatcctgactgtgccttaaactcagca
gtaacctccactcgaagagaggccccacccctctgtgcagaacatggtgccagcctcttc
attcctttcttagtggttctggcttcagttattcaaccgtga

DBGET integrated database retrieval system