KEGG   Felis catus (domestic cat): 101101277Help
Entry
101101277         CDS       T02385                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04620  Toll-like receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04972  Pancreatic secretion
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05231  Choline metabolism in cancer
fca05416  Viral myocarditis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101101277 (RAC1)
   04015 Rap1 signaling pathway
    101101277 (RAC1)
   04010 MAPK signaling pathway
    101101277 (RAC1)
   04310 Wnt signaling pathway
    101101277 (RAC1)
   04370 VEGF signaling pathway
    101101277 (RAC1)
   04071 Sphingolipid signaling pathway
    101101277 (RAC1)
   04024 cAMP signaling pathway
    101101277 (RAC1)
   04151 PI3K-Akt signaling pathway
    101101277 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101101277 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101277 (RAC1)
   04520 Adherens junction
    101101277 (RAC1)
   04530 Tight junction
    101101277 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101101277 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101101277 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    101101277 (RAC1)
   04662 B cell receptor signaling pathway
    101101277 (RAC1)
   04664 Fc epsilon RI signaling pathway
    101101277 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    101101277 (RAC1)
   04670 Leukocyte transendothelial migration
    101101277 (RAC1)
   04062 Chemokine signaling pathway
    101101277 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    101101277 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101101277 (RAC1)
  09158 Development
   04360 Axon guidance
    101101277 (RAC1)
   04380 Osteoclast differentiation
    101101277 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101277 (RAC1)
   05205 Proteoglycans in cancer
    101101277 (RAC1)
   05203 Viral carcinogenesis
    101101277 (RAC1)
   05231 Choline metabolism in cancer
    101101277 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101101277 (RAC1)
   05212 Pancreatic cancer
    101101277 (RAC1)
   05211 Renal cell carcinoma
    101101277 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101101277 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101101277 (RAC1)
   05416 Viral myocarditis
    101101277 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101101277 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101101277 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101101277 (RAC1)
   05100 Bacterial invasion of epithelial cells
    101101277 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101101277 (RAC1)
   05163 Human cytomegalovirus infection
    101101277 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101277 (RAC1)
   05169 Epstein-Barr virus infection
    101101277 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101277 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101101277 (RAC1)
   04031 GTP-binding proteins [BR:fca04031]
    101101277 (RAC1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101101277 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101101277 (RAC1)
  Phagocytosis
   NADPH oxidase complex
    101101277 (RAC1)
  Macropinocytosis
   Ras GTPases
    101101277 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101101277 (RAC1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101101277 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   101101277 (RAC1)
  Exosomal proteins of colorectal cancer cells
   101101277 (RAC1)
  Exosomal proteins of bladder cancer cells
   101101277 (RAC1)
GTP-binding proteins [BR:fca04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101101277 (RAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Motif
Other DBs
NCBI-GeneID: 101101277
NCBI-ProteinID: XP_023101983
Ensembl: ENSFCAG00000011361
Position
E3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagccgtaggtaaaacgtgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccccactgtctttgacaactac
tctgccaatgttatggtggatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccttatcctatccgcaaacagatgtattcttaatt
tgcttttctcttgtgagtcctgcgtcatttgaaaatgttcgagcaaagtggtaccctgaa
gtgcgacaccactgtcccaacacccccatcatcttggtgggaactaaacttgacctcagg
gacgacaaagacacgattgagaaactgaaggagaaaaagctgactcccatcacctacccg
caggggttggccatggcgaaggagatcggtgctgtaaaatacctggagtgctcggcgctc
acgcagcgaggcctcaagacagtgtttgatgaagctattcgagcggttctctgcccccct
cccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system