KEGG   Felis catus (domestic cat): 101101295
Entry
101101295         CDS       T02385                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101101295 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101101295 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101101295
NCBI-ProteinID: XP_004000928
UniProt: A0A337S4B6
Position
X
AA seq 77 aa
MNLRRCVQALLLLWLSLTAACGGPLLQPSDGNGLEESNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggcggtgcgtgcaggcgctcctgctgctctggctctccctgaccgcggcg
tgtggagggcccctgctgcagccttctgatgggaatgggctggaggaaagcaatgtccgc
cacctggtgcagcccagagggtcgaggaatggaccagggccatggcagggaggtcggagg
aaattccgccgccagcggccgcgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system