KEGG   Felis catus (domestic cat): 101101356Help
Entry
101101356         CDS       T02385                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101101356 (RB1)
   04218 Cellular senescence
    101101356 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101356 (RB1)
   05203 Viral carcinogenesis
    101101356 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101101356 (RB1)
   05225 Hepatocellular carcinoma
    101101356 (RB1)
   05226 Gastric cancer
    101101356 (RB1)
   05214 Glioma
    101101356 (RB1)
   05220 Chronic myeloid leukemia
    101101356 (RB1)
   05218 Melanoma
    101101356 (RB1)
   05219 Bladder cancer
    101101356 (RB1)
   05215 Prostate cancer
    101101356 (RB1)
   05224 Breast cancer
    101101356 (RB1)
   05222 Small cell lung cancer
    101101356 (RB1)
   05223 Non-small cell lung cancer
    101101356 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101356 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101101356 (RB1)
   05161 Hepatitis B
    101101356 (RB1)
   05160 Hepatitis C
    101101356 (RB1)
   05163 Human cytomegalovirus infection
    101101356 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101356 (RB1)
   05169 Epstein-Barr virus infection
    101101356 (RB1)
   05165 Human papillomavirus infection
    101101356 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101101356 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101101356 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101101356 (RB1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101101356 (RB1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    101101356 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Motif
Other DBs
NCBI-GeneID: 101101356
NCBI-ProteinID: XP_023107197
Ensembl: ENSFCAG00000024529
Position
A1
AA seq 930 aa AA seqDB search
MPPKTPRRAAAAAAAAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLPRLVFEETEEPDF
IALCQKLKIPDHVRERAWFTWEKVSSVDGVLEGYSQRKKELWGICIFIAAVDLDEMPFTF
TELQKNIETSVYKFFDLLKEVDTSTKVDNAMSRLLKKYKVLCALYSKLERTCEHIYLTQP
GSLLSTEINSLLVLKASWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKE
PYKTAVIPFNGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFI
PFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSFEMQRTP
RKSSSDEEVNTMLPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILK
RVKDIGCIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLL
NDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIK
AEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESACTLSLPLQ
SNHTAADMYLSPIRSPKKKGTTRVNSTANTEAQATSAFQTQKPLKSTSLSLFYKKVYRLA
YLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNID
LKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPT
LSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGVPTPTKMTPRSRILVSIGES
FGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQ
QKLAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagcagccgcagccgccgctgccgccgccgccgcc
gccgaacccccggcgccgccgccgccgccccctcctgaagaggaccccgagcaggacagc
ggccccgaggacttgcctctgcccaggcttgtatttgaagaaactgaagaacctgatttt
attgcattatgtcagaaattaaagataccagatcatgtcagagaaagagcttggtttact
tgggaaaaagtttcatctgtggatggagtgttggaaggttatagtcaaaggaaaaaggaa
ctatggggaatctgtatctttattgcagcagttgacctagatgagatgccattcaccttt
actgagctacagaaaaacatagaaaccagtgtctacaaattctttgatttactaaaagaa
gttgatacgagtaccaaagttgataatgctatgtcaagactgttgaagaagtataaggta
ttgtgtgcactctacagcaaattggaaaggacatgtgaacatatatatttgacacaacct
ggcagtttgctatctactgaaataaactctctgttggtgctaaaagcttcttggatcaca
tttttactagctaaaggggaagtgttacaaatggaagatgatctcgtcatctcatttcag
ttaatgctctgtgtccttgattattttattaaactctcacctcctgcgttgcttaaagaa
ccatataaaacagctgtaataccttttaatggttcacctcgaacaccaaggcgaggtcag
aacaggagtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctc
tgtaaagaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaatttcata
ccttttatgaattctcttggaattgtagcttctaatggacttccagaggtggaaagtctc
tctaaacaatatgaagaaatttaccttaaaaacaaagatcttgatgcaagattatttctg
gatcatgataaaactcttcaggctgatcctacagacagttttgaaatgcagagaacacca
cgaaaaagtagctctgatgaagaggtgaatacgatgcttccgcagactccagttaggacc
gttatgaatactattcaacagttaatgatgatcttaaattcagcaagtgatcaaccatca
gaaaatctgatttcctattttaataactgcacagtgaatccaaaggaaagtatcctgaaa
agggtgaaggatattggatgcatctttaaagagaaatttgctaaagctgtgggacaggga
tgtatggaaattggatcacagagatacaaacttggagtccgattatattaccgagtaatg
gaatctatgcttaaatcagaagaagaacgattatccattcaaaattttagtaaactcctg
aatgacaacatctttcatatgtctttgttggcatgcgctcttgaggttgtaatggctaca
tatagcagaagtacatctcagaatcttgatactggaacagatttgtccttcccatggatt
ctgaatgtacttaatttaaaagcctttgatttttacaaagtgattgaaagttttatcaaa
gcagaagccaacttgaccagagaaatgataaaacatttagagcgatgtgaacatcgaatc
atggaatcccttgcatggctctctgattcacctttatttgatctaattaaacaagcaaag
gaccgagaaggaccagctgatcaccttgaatctgcttgtactctcagccttcctctccag
agtaatcacactgcagcagatatgtatctttctccaatcagatccccaaagaaaaaagga
actacacgtgtaaattctactgcaaacacagaggcacaagcaacctcagccttccagact
cagaagccattgaaatctacctccctttcacttttttacaaaaaagtgtaccgactggcc
tatcttcgactaaataccctgtgtgcacgccttctgtctgaccaccctgaactggaacac
atcatctggaccctttttcagcacacactgcaaaatgagtatgaactcatgagagacagg
catttggatcagattatgatgtgttccatgtatggcatttgcaaagtgaagaatatagac
cttaaattcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagaca
ttcaaacgagttttgatcagagaagaggagtatgattccattatagtattctataactca
gtcttcatgcagagacttaaaacaaatattttgcagtatgcttctaccaggcccccgact
ttgtcaccaatacctcacattcctcgaagcccttacaagttttctagttcacctttacga
attcctgggggaaacatctatatatcacccctgaagaatccatataaaatttcagaaggt
gtgccaacaccaacaaaaatgactccaagatcgagaatcttagtatcaattggtgaatca
tttgggacttctgagaagttccagaaaataaatcagatggtgtgtaacagcgaccgtgtg
ctcaaaagaagtgctgaaggaggcaaccctcctaaaccgctgaaaaaactacgctttgat
attgaaggatcagatgaagcagacggaagtaaacatctcccaggggaatccaaatttcaa
cagaaactggcagaaatgacatctacccgaacacgaatgcagaagcaaaaaatgaacgat
agcatggatacctcaaacagggaagaaaaatga

DBGET integrated database retrieval system