KEGG   Felis catus (domestic cat): 105261262Help
Entry
105261262         CDS       T02385                                 

Gene name
CEBPA
Definition
(RefSeq) CCAAT/enhancer-binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105261262 (CEBPA)
   05202 Transcriptional misregulation in cancer
    105261262 (CEBPA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    105261262 (CEBPA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105261262 (CEBPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    105261262 (CEBPA)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    105261262 (CEBPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 TolA_bind_tri bZIP_Maf Lipoprotein_20 Nup54 DivIC DUF2514
Motif
Other DBs
NCBI-GeneID: 105261262
NCBI-ProteinID: XP_023101053
Position
E2
AA seq 359 aa AA seqDB search
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGSAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGAGGGDFDYTGAPGGPGGAAMP
GGTHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPY
QPPPPPPPPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGA
AGLPGPGGALKGLAAAHPDLRAGGGGGGGGGAGKVKKSVDKNSNEYRVRRERNNIAVRKS
RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agtcccccgcacgcgcccagcagcgccgccttcggctttccccggggcgcgggctccgcg
cagccccccgccccacctgccgccccagagccgctgggcggcatctgcgaacacgagacg
tccatcgacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctgttccagcacagccggcagcaggagaaggccaaggcggctgcggcccccgcaggagcc
ggcggcggtgactttgactacacgggcgcccccggggggcccggcggcgccgcgatgccg
ggagggacgcacggcccccctcctggctacggctgcgccgcggccggctacctggacggc
aggctggagcccctgtacgagcgcgtcggggcgccggcgttgcgaccgctggtgatcaag
caggagccgcgcgaggaggacgaggcgaagcagctggcgctggccggcctcttcccctac
cagccgccgccgccgccgccgccgccgcacccgcacccaccgcccgcgcacctggccgcc
cctcacctgcagttccagatcgcgcactgcggccagaccaccatgcacctgcagcccggc
caccccacgccgccgcccacgcccgtgcccagccctcacccagcaccggctctcggtgcc
gctggcttgccaggccccggcggcgcgctcaaggggctggcggccgcgcaccccgacctc
cgcgcgggcggcggcggcggcggcggcggcggcgcgggcaaagtcaagaagtcggtggac
aagaacagcaacgagtaccgggtgcggcgcgagcgcaacaacatcgcggtgcgcaagagc
cgggacaaggccaagcagcgcaacgtggagacacagcagaaggtgctggagctgaccagt
gacaatgaccgcctgcgcaagcgggtggaacaactgagccgcgaactggacacgctgcgg
ggcatcttccgccagctgcccgagagctccctggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system