KEGG   Felis catus (domestic cat): 111559107Help
Entry
111559107         CDS       T02385                                 

Definition
(RefSeq) cytochrome P450 2E1-like
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00140  Steroid hormone biosynthesis
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01100  Metabolic pathways
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    111559107
   00590 Arachidonic acid metabolism
    111559107
   00591 Linoleic acid metabolism
    111559107
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111559107
   00982 Drug metabolism - cytochrome P450
    111559107
   00983 Drug metabolism - other enzymes
    111559107
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    111559107
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    111559107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fca00199]
    111559107
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     111559107
Cytochrome P450 [BR:fca00199]
 Cytochrome P450, animal type
  CYP2 family
   111559107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 111559107
NCBI-ProteinID: XP_023105447
Position
D2
AA seq 184 aa AA seqDB search
MAALGITVALLVWMATLMLISVWKQIYSSWKLPPGPFPLPIIGNLLQLDFKNVPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEVLLDYKNDFSGRGEIYAFEAHKDKGEPHFSEH
PPWWNSFDWSFQVLSGALLPHENSSYGVKELCTSSTEPLSATPGPSHGSLNAAFIIHMMC
ETSS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctgggcatcacagttgccctgttggtgtggatggccaccctcatgcttatc
tctgtctggaagcagatctacagcagctggaaactaccccctggccctttcccactgccc
attattgggaatcttctccagttggatttcaagaatgttcccaaatctttaaccaagttg
gcagagcggtatgggcctgtgttcaccttgtacctgggctcccagcgcaccgtagttctg
catggctataaggcggtgaaggaagtcctgctcgactacaagaatgacttttctggcaga
ggagaaatctatgcgtttgaggcacacaaggataaaggtgagccccacttctcagagcac
cccccctggtggaacagctttgactggtcctttcaggtcctttcaggagctttgctgccc
cacgagaacagcagttatggggtcaaggagctctgtactagctccacggagcccttatct
gccacccctggtccaagtcatgggtccctgaatgcagcctttatcatacacatgatgtgt
gagacctcaagt

KEGG   Felis catus (domestic cat): 554227Help
Entry
554227            CDS       T02385                                 

Gene name
CYP2E2
Definition
(RefSeq) cytochrome P450 2E2
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00140  Steroid hormone biosynthesis
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01100  Metabolic pathways
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    554227 (CYP2E2)
   00590 Arachidonic acid metabolism
    554227 (CYP2E2)
   00591 Linoleic acid metabolism
    554227 (CYP2E2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    554227 (CYP2E2)
   00982 Drug metabolism - cytochrome P450
    554227 (CYP2E2)
   00983 Drug metabolism - other enzymes
    554227 (CYP2E2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    554227 (CYP2E2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    554227 (CYP2E2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fca00199]
    554227 (CYP2E2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     554227 (CYP2E2)
Cytochrome P450 [BR:fca00199]
 Cytochrome P450, animal type
  CYP2 family
   554227 (CYP2E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 554227
NCBI-ProteinID: NP_001041475
Ensembl: ENSFCAG00000013762
UniProt: Q5KR51
Position
D2
AA seq 495 aa AA seqDB search
MAALGITVALLVWMATLMLISVWKQIYSSWKLPPGPFPLPIIGNLLQLDFKNVPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEVLLDYKNDFSGRGEIYAFEAHKEKGITFNNGP
SWKDTRRLSLSILRDYGMGKLANEERIQREVPFLMEAFRKTQGQPFDPTFVLGYAPCNVI
SDILFRKRFDYTDQTGLRIQKLFNENFHLLSTSWLQLYNIFPSYMRYLPGNHRKVIKNVY
EIKSYTAARVKEHEESLDPNCPRDFTDSLLLEMRKERYTKEPWFTFDNIAATIADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHEAIQDTMFRGYVIPKGTVVVPTLDSLLFDNQEFPDPEKFKPEHFLNESGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLFLSAILQHFNLKPLVDPKDIDLSPSTIGFAK
IPPRYKLCVIPRSGV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctgggcatcacagttgccctgttggtgtggatggccaccctcatgcttatc
tctgtctggaagcagatctacagcagctggaaactaccccctggccctttcccactgccc
attattgggaatcttctccagttggatttcaagaatgttcccaaatctttaaccaagttg
gcagagcggtatgggcctgtgttcaccttgtacctgggctcccagcgcaccgtagttctg
catggctataaggcggtgaaggaagtcctgctcgactacaagaatgacttttctggcaga
ggagaaatctatgcatttgaggcacacaaggaaaaaggaattacgttcaacaatgggccg
agctggaaggacacccggcgcctgtctctgagcatcctccgggactatggcatggggaag
cttgccaatgaggagcggatccagagggaggtgcccttcctgatggaggcattccggaag
acccaggggcagcccttcgaccccacctttgttctgggctatgctccctgcaacgtcatc
tcggacatcctcttccgcaagcgctttgactacacggaccaaaccgggctgaggatacag
aagctgttcaacgagaacttccacctgctcagcaccagctggctccaattatataacatt
ttcccaagctatatgcgctacctgcctggaaaccatagaaaagtaataaaaaatgtgtat
gaaataaaaagttatactgcagcaagagtgaaggagcacgaggagtcgctggaccccaac
tgcccccgggacttcaccgacagcctgctcctggagatgcggaaggaaagatacaccaaa
gagccttggttcacctttgacaacattgctgccaccatagctgacctgttttttgcgggt
acagagaccaccagcaccactctgagatatgggctcctgattctcatgaaatacccagag
atcgaagagaaactgcatgaagaaatcgacagggtgattgggccaagccgaatccctgcc
atcaaggaccggttagagatgccctatatggatgccgtggtgcatgagattcagcgattc
atcgacctcttgccctccaacctgccccatgaagcaatccaggacacaatgttcagagga
tacgtcatccccaagggtacggtcgtggtcccgacgctggactccctcttgtttgacaac
caagagttccctgatccggagaagtttaagccagagcactttctgaatgaaagtggaaag
ttcaagtatagtgactatttcaaggcattttctgcaggaaagcgggtgtgtgttggagaa
ggcctggctcgcatggagttgttcctgttcttgtccgccattttgcagcactttaacctg
aagcctctcgttgaccccaaggatatcgatctcagtcccagcacaattgggtttgccaaa
atcccaccccgttacaagctctgtgtcattccccgttcgggtgtgtga

DBGET integrated database retrieval system