KEGG   Felis catus (domestic cat): 111559702Help
Entry
111559702         CDS       T02385                                 

Gene name
OXT
Definition
(RefSeq) oxytocin-neurophysin 1
  KO
K05243  oxytocin-neurophysin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    111559702 (OXT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111559702 (OXT)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111559702 (OXT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 111559702
NCBI-ProteinID: XP_023106682
Position
A3
AA seq 125 aa AA seqDB search
MAGSSLACCLLGLLALTSACYIQNCPLGGKRAALDLDVRQCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCQEENYLPSPCQSGHKPCGSGGRCAAAGICCNDDGCRADPACDAEA
AFSQR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccggctccagcctcgcctgctgcctgctcggcctcctggcgctgacctccgcctgc
tacatccagaactgccccctgggcggcaagagggccgcgctggacctcgacgtgcgccag
tgcctcccctgcggacccgggggcaaagggcgctgcttcgggcccagcatctgctgcggc
gacgagctcggctgcttcgtgggcacggccgaggcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtcgggccacaagccgtgcgggagcgggggccgctgcgccgcc
gcggggatctgctgcaacgacgacggctgccgcgccgaccccgcctgcgacgccgaggcc
gccttctcccagcgctga

DBGET integrated database retrieval system