KEGG   Felis catus (domestic cat): 414734Help
Entry
414734            CDS       T02385                                 

Gene name
GATM
Definition
(RefSeq) glycine amidinotransferase, mitochondrial
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00260  Glycine, serine and threonine metabolism
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    414734 (GATM)
   00330 Arginine and proline metabolism
    414734 (GATM)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     414734 (GATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-GeneID: 414734
NCBI-ProteinID: XP_003987241
Ensembl: ENSFCAG00000023809
UniProt: M3X5Y1
Position
B3
AA seq 423 aa AA seqDB search
MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATDPL
PKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKHGGHYFPKDHL
KKAVTEIEEMCNILKMEGVTVRRPDPIDWSLKYKTPDFESTGLYGAMPRDILIVVGNEII
EAPMAWRARFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADKLYDENYPIHSVEDRHKLAA
QGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
PMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPIPVIPDDHPLWMSSKWLSM
NVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS
YFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggtgcggtgtctgcgcggcgggagccgcggcgccgaggcggtgcactacatc
ggttctcggcttggaagaaccttaacaggatgggtgcagcgaactttccagagcacccag
gcagctactgcttcctcccggaattcctgtgcagctgacgataaggccactgatcctctg
cccaaggactgccctgtctcctcttacaatgaatgggaccccttagaggaagtgatcgtg
ggcagagctgaaaatgcctgtgttccaccgttcaccgtggaggtgaaggccaacacatat
gaaaagtactggccattttaccagaagcacggaggccattattttcccaaagatcatttg
aaaaaggctgttactgaaattgaagagatgtgcaatattttaaaaatggaaggagtgaca
gtgaggaggcctgaccccattgactggtcgttgaagtataaaactcctgattttgagtct
acgggtttatatggtgcgatgcctcgagatatcctgatagttgtgggaaatgagattatc
gaggctcccatggcatggcgtgcccgcttctttgagtaccgggcataccggtcaattatc
aaagactacttccaccgtggcgccaagtggacaacggctcctaaaccaacaatggctgat
aagctttatgatgagaattaccctatccattctgtagaagacagacacaaattggctgct
cagggaaagtttgtgacgactgagttcgagccatgctttgatgctgctgacttcattaga
gctggaagagatatttttgcacagagaagccaggttacaaactatctaggcattgaatgg
atgcgtaggcatcttgctccagactacagagtgcatatcatctcctttaaagaccccaat
ccaatgcatattgatgccaccttcaatatcattggacctggtcttgtgctttccaaccct
gatcgaccgtgtcatcagattgatcttttcaagaaagcaggatggaccatagttactcct
ccaataccagtcatcccagatgatcacccactctggatgtcatccaaatggctttccatg
aatgtcttaatgctagatgaaaaacgtgtcatggtggatgccaatgaagtcccaattcaa
aagatgtttgaaaagctgggtatcagtactatcaaggttaacatccgtaatgccaattcc
ctgggaggaggcttccactgctggacctgcgatgtccggcgccgaggcaccctgcagtcc
tactttgactga

DBGET integrated database retrieval system