KEGG   Felis catus (domestic cat): 493679Help
Entry
493679            CDS       T02385                                 

Gene name
MMP13
Definition
(RefSeq) collagenase 3
  KO
K07994  matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04657  IL-17 signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    493679 (MMP13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    493679 (MMP13)
   04928 Parathyroid hormone synthesis, secretion and action
    493679 (MMP13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    493679 (MMP13)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     493679 (MMP13)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M10
   493679 (MMP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_4 Reprolysin_5 DUF4953
Motif
Other DBs
NCBI-GeneID: 493679
NCBI-ProteinID: XP_023094811
Ensembl: ENSFCAG00000000118
Position
D1
AA seq 470 aa AA seqDB search
MHRAFLAALLLWSWARCRSLPLPSDGDDDLSEEDFQLAERYLKSYYYPMNPAGILKKAAT
SSVADRLREMQAFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKTNLTYR
IVNYTPDLTHPEVEKAFKKALKVWSDVTPLNFTRLHDGTADIMISFGTKEHGDFYPFDGP
SGLLAHAFPPGPNYGGDAHFDDDETWTSTSKGYNLFLVAAHEFGHSLGLDHSKDPGALMF
PIYTYTGQSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLTLDAITSLRGETM
IFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSRDLIFIFRGRKFWALNGYD
ILEGYPKKISELGFPKDVKKISAAVHFEDTGKTLFFSGNQVWSYDDSNHAMDQDSPRLIE
EDFPGIGDKVDAVYEKNGYIYFFNGPLQFEYSIWSNRIVRVLPANSLLWC
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgggccttcctcgccgccctcctcctctggagctgggctcgctgtcggtccctg
ccccttcccagcgatggtgacgacgacctgtccgaggaagacttccagttggcagagcgc
tacctgaaatcctactactacccgatgaatcccgctggaatcctgaagaaagcggccacg
agctccgtggccgacaggctccgagaaatgcaagccttttttggcttagaggtcaccggc
aagctcgatgacaacaccttagacgtcatgaagaaaccgagatgtggggtccctgatgtg
ggcgagtacaacgttttcccccgaacgctcaagtggtccaagacgaacttaacctacagg
attgtgaattatacccctgatctgactcatcctgaagtcgaaaaggcattcaaaaaagcc
ctcaaagtctggtctgatgtgacaccactgaacttcaccagactccatgacggcactgct
gacatcatgatctcttttggaactaaagagcatggcgacttctacccatttgatggaccc
tctggtctgctggctcacgcttttcctcctgggccaaattatggaggcgacgcccatttt
gatgatgacgaaacatggacaagtacttccaaaggttacaacttgtttcttgtcgctgcc
cacgagtttggccactccttaggtctcgaccactccaaggacccaggagcactcatgttt
cccatctacacctacactggccaaagccacttcatgcttcctgatgacgacgtacaaggg
atccagtctctctatggcccgggagatgaggaccccaacccgaaacatcccaaaacgccg
gacaaatgtgacccgtccctgaccctcgacgccatcaccagtctccgaggagagaccatg
atctttaaagacagattcttctggcgcctgcacccccagcaggtggacgcagagctgttt
ttaacaaaatccttttggccggaacttcccaaccgcatcgacgccgcctacgagcacccc
tcccgtgaccttatcttcatctttagaggcagaaaattttgggctcttaatggttatgac
attctggaaggttaccccaaaaaaatatccgaactgggatttccaaaagatgttaaaaag
ataagtgctgctgtccactttgaggacacagggaagacgctcttcttctcgggaaaccag
gtctggagctatgatgacagcaaccacgccatggatcaggactcccccaggctgatcgaa
gaggactttccagggattggtgataaagtggatgccgtctacgagaaaaacggttacatc
tattttttcaacgggcccctccagtttgaatacagcatctggagcaaccgtattgttcgc
gtcctgccagcaaattccctgttgtggtgttaa

DBGET integrated database retrieval system