KEGG   Felis catus (domestic cat): 493701Help
Entry
493701            CDS       T02385                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01524  Platinum drug resistance
fca04014  Ras signaling pathway
fca04064  NF-kappa B signaling pathway
fca04115  p53 signaling pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04621  NOD-like receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05145  Toxoplasmosis
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    493701 (BCL2L1)
   04630 Jak-STAT signaling pathway
    493701 (BCL2L1)
   04064 NF-kappa B signaling pathway
    493701 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    493701 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    493701 (BCL2L1)
   04137 Mitophagy - animal
    493701 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    493701 (BCL2L1)
   04215 Apoptosis - multiple species
    493701 (BCL2L1)
   04115 p53 signaling pathway
    493701 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493701 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493701 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    493701 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    493701 (BCL2L1)
   05225 Hepatocellular carcinoma
    493701 (BCL2L1)
   05220 Chronic myeloid leukemia
    493701 (BCL2L1)
   05222 Small cell lung cancer
    493701 (BCL2L1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    493701 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493701 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    493701 (BCL2L1)
   05162 Measles
    493701 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    493701 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493701 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493701 (BCL2L1)
   01524 Platinum drug resistance
    493701 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    493701 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    493701 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    493701 (BCL2L1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493701 (BCL2L1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    493701 (BCL2L1)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   493701 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 493701
NCBI-ProteinID: NP_001009228
Ensembl: ENSFCAG00000025748
UniProt: Q8SQ42
Position
A3
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcggtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtcaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgctccaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system