KEGG   Felis catus (domestic cat): 493706Help
Entry
493706            CDS       T02385                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor precursor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    493706 (CSF1R)
   04015 Rap1 signaling pathway
    493706 (CSF1R)
   04010 MAPK signaling pathway
    493706 (CSF1R)
   04151 PI3K-Akt signaling pathway
    493706 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493706 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493706 (CSF1R)
  09158 Development
   04380 Osteoclast differentiation
    493706 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493706 (CSF1R)
   05202 Transcriptional misregulation in cancer
    493706 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    493706 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    493706 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493706 (CSF1R)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     493706 (CSF1R)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   493706 (CSF1R)
CD molecules [BR:fca04090]
 Proteins
  493706 (CSF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set ig Ig_2 V-set
Motif
Other DBs
NCBI-GeneID: 493706
NCBI-ProteinID: NP_001009231
Ensembl: ENSFCAG00000003633
UniProt: P13369
Position
A1
AA seq 980 aa AA seqDB search
MGPRALLVLLVATAWHAQGVPVIQPSGPELVVEPGTTVTLRCVGNGSVEWDGPISPHWNL
DLDPPSSILTTNNATFQNTGTYHCTEPGNPQGGNATIHLYVKDPARPWKVLAQEVTVLEG
QDALLPCLLTDPALEAGVSLVRVRGRPVLRQTNYSFSPWHGFTIHKAKFIENHVYQCSAR
VDGRTVTSMGIWLKVQKDISGPATLTLEPAELVRIQGEAAQIVCSASNIDVNFDVSLRHG
DTKLTISQQSDFHDNRYQKVLTLNLDHVSFQDAGNYSCTATNAWGNHSASMVFRVVESAY
LNLTSEQSLLQEVTVGEKVDLQVKVEAYPGLESFNWTYLGPFSDYQDKLDFVTIKDTYRY
TSTLSLPRLKRSEAGRYSFLARNAGGQNALTFELTLRYPPEVRVTMTLINGSDTLLCEAS
GYPQPSVTWVQCRSHTDRCDESAGLVLEDSHSEVLSQVPFHEVIVHSLLAIGTLEHNRTY
ECRAFNSVGNSSQTFWPISIGAHTQLPDELLFTPVLLTCMSIMALLLLLLLLLLYKYKQK
PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFG
LGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVIT
EYCCYGDLLNFLRRQAEAMLGPSLSVGQDPEAGAGYKNIHLEKKYVRRDSDFSSQGVDTY
VEMRPVSTSSSNDSFSEEDLGKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGRVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTRRPT
FQQICSLLQKQAQEDRRVPNYTNLPSSSSSSSSSSSSCRTGSGGGSSSEPEEESSSEHLA
CCEQGDIAQPLLQPNNYQFC
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaagggctctgctcgtcctgctggtggccacagcttggcatgctcaaggggtc
ccagtgatacagcccagcggccctgagctggtcgtggagccaggcacaacagtgaccctg
cgatgtgtgggcaacggcagcgtggaatgggacggccccatctccccccactggaacctg
gacctcgatccccccagcagcatcctgaccacgaataatgccaccttccaaaacacgggg
acctatcactgcactgagcctggaaacccccaggggggcaatgccaccatccacctctat
gtcaaagaccctgctcggccttggaaggtgctggcccaggaagtgacggtgttggaaggt
caggatgcgttgctgccctgcctgcttactgacccagcgttggaggcaggcgtctcgctg
gtgcgggtgcgtggccggcccgtcttgcgccaaaccaactattccttctcgccctggcat
ggcttcaccatccacaaggccaagttcattgagaatcacgtctaccaatgcagtgcgcga
gtagacggcaggacggtgacatcgatgggcatctggcttaaagtgcagaaagacatctcc
gggcctgcaaccttgacgctggagcctgcagagctggtgcggattcaaggagaggctgcc
cagatcgtgtgctcagccagcaacattgatgttaactttgacgtctccctccgtcatgga
gacaccaagctcacaatctctcaacaatccgacttccatgataaccgttaccaaaaagtc
ctgaccctcaacctcgatcacgtgagcttccaagatgctggcaactactcctgcacggcc
accaacgcctggggcaaccactccgcctccatggtcttccgggtggtagagagtgcctac
ttgaacttgacctctgagcagagtctcctccaggaggtgactgtgggtgagaaggttgat
ctccaagtcaaggtggaggcctacccaggcctagaaagttttaactggacctatctggga
cccttctctgactaccaggacaagctcgattttgtcaccatcaaggacacatacaggtac
acctcgaccctctccctgcctcgcctgaagcgctcggaggccggtcgctactccttcttg
gcccgaaacgctggaggccagaatgccctgacctttgagctcaccctgcgataccccccg
gaggtaagggtcacgatgaccctcatcaatggctctgacaccctgctctgtgaagcctcc
gggtacccccagcccagtgtgacgtgggtgcagtgcaggagccacaccgataggtgtgat
gagtctgcagggctcgtcctagaggactcacactctgaggtcctgagccaagtgcccttc
cacgaggtgatcgtccatagcctgctggccatcgggaccttggaacacaacaggacatat
gagtgtagagccttcaacagcgtggggaacagctcccagaccttctggcccatctctata
ggagcccacacgcagctccccgacgagctcctcttcacgcccgtgctgctcacttgcatg
tccatcatggccttgttgctgctgctgctcttgctgcttttgtacaagtataagcagaag
cccaagtaccaggtgcgctggaagatcatcgagagctacgagggcaacagctacaccttc
atcgaccccacccagctgccctacaatgagaagtgggagttcccccgaaacaacctgcag
tttggtaagactcttggagccggtgccttcgggaaggtggtagaggccacagcctttggt
ctgggcaaggaagatgccgtcctgaaggtggctgtgaagatgctgaagtccactgctcat
gcagatgagaaggaggccctcatgtcagaactgaagatcatgagtcacctgggccaacac
gagaacatagtcaaccttctgggagcctgtacccatggaggccctgttctggtcatcact
gagtactgttgctacggcgacctgctcaacttcctgcgaaggcaggctgaggccatgctg
ggccccagcctgagtgtgggccaggaccccgaggcaggcgctggctacaagaacatccac
ctggagaagaaatatgttcgcagagacagcgatttctccagtcagggtgtagacacctat
gtggagatgaggcctgtctccacttcttcttcaaatgactccttctctgaagaagacctg
ggcaaggaggacgggaggccactggagctacgggacctgctccacttctcgagccaggtg
gcccaggggatggccttccttgcctctaagaactgcatccaccgggacgtggcagcccga
aacgtcctgctgaccagtgggcgtgtggccaagattggggacttcgggttggctagggac
atcatgaatgactccaactacatcgtcaagggcaatgcccgcctgcctgtgaagtggatg
gctccggagagcatcttcgactgtgtctacacggttcagagcgacgtctggtcctatggc
atcttgctctgggaaatcttctcactcgggctgaacccctaccctggcatcctggtgaac
agcaagttctacaaactggtgaaggatggataccaaatggcccagcctgcattcgcccca
aagaacatatatagcatcatgcaggcctgctgggccctggagcccacccgcagacccacg
ttccagcagatctgctccctcctccagaagcaggcccaagaggacaggagagtgccgaac
tacaccaacttgccaagcagcagcagcagcagcagcagcagcagcagcagctgccgcact
ggcagtggcggtggcagcagtagtgagcccgaggaggagagctctagcgagcacctggcc
tgctgtgagcagggggatatcgcccagcccctgctgcagcccaacaactaccagttctgc
tga

DBGET integrated database retrieval system