KEGG   Felis catus (domestic cat): 493741Help
Entry
493741            CDS       T02385                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha precursor
  KO
K05406  interleukin 12A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04620  Toll-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04940  Type I diabetes mellitus
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493741 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493741 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493741 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    493741 (IL12A)
   04625 C-type lectin receptor signaling pathway
    493741 (IL12A)
   04658 Th1 and Th2 cell differentiation
    493741 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493741 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    493741 (IL12A)
   05330 Allograft rejection
    493741 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493741 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    493741 (IL12A)
   05134 Legionellosis
    493741 (IL12A)
   05152 Tuberculosis
    493741 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    493741 (IL12A)
   05164 Influenza A
    493741 (IL12A)
   05168 Herpes simplex virus 1 infection
    493741 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493741 (IL12A)
   05144 Malaria
    493741 (IL12A)
   05145 Toxoplasmosis
    493741 (IL12A)
   05140 Leishmaniasis
    493741 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    493741 (IL12A)
   05143 African trypanosomiasis
    493741 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493741 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493741 (IL12A)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   493741 (IL12A)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   493741 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12
Motif
Other DBs
NCBI-GeneID: 493741
NCBI-ProteinID: NP_001009833
Ensembl: ENSFCAG00000011130
UniProt: O02743
Position
C2
AA seq 222 aa AA seqDB search
MCPPRGLLLVTILVLLNHLDHLSLARNLPTPTPSPGMFQCLNHSQTLLRAISNTLQKARQ
TLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKTS
FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNVNSVTV
PQNSSLEEPDFYKTKIKLCILLHAFRIRAVTINRMMSYLNSS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccgccgcgtggcctcctccttgtaaccatcctggtcctgttaaaccacctggac
cacctcagtttggccaggaacctccccacacccacaccaagcccaggaatgttccagtgc
ctcaaccactcccaaaccctgctgcgagccatcagcaacacgcttcagaaggccagacaa
actctagaattttacccctgcacttccgaagagattgatcatgaagatatcacaaaagat
aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg
gcttccagagagatctctctgataactaatgggagttgcctggcctccagaaagacctct
tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaatgcaaagctgttaatggatcctaaaaggcagatctttctggatcaa
aacatgctgacagctattgatgagctgttacaggccctgaatgtcaacagtgtgactgtg
ccacagaactcctccttggaagaaccggatttttataaaactaaaatcaagctctgcata
cttcttcatgctttcagaattcgtgcagtgaccatcaatagaatgatgagctatctgaat
tcttcctaa

KEGG   Felis catus (domestic cat): 768273Help
Entry
768273            CDS       T02385                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04620  Toll-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04940  Type I diabetes mellitus
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    768273 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    768273 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    768273 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    768273 (IL12B)
   04625 C-type lectin receptor signaling pathway
    768273 (IL12B)
   04658 Th1 and Th2 cell differentiation
    768273 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768273 (IL12B)
   05205 Proteoglycans in cancer
    768273 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    768273 (IL12B)
   05330 Allograft rejection
    768273 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    768273 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    768273 (IL12B)
   05134 Legionellosis
    768273 (IL12B)
   05152 Tuberculosis
    768273 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    768273 (IL12B)
   05164 Influenza A
    768273 (IL12B)
   05168 Herpes simplex virus 1 infection
    768273 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    768273 (IL12B)
   05145 Toxoplasmosis
    768273 (IL12B)
   05140 Leishmaniasis
    768273 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    768273 (IL12B)
   05143 African trypanosomiasis
    768273 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    768273 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    768273 (IL12B)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   768273 (IL12B)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   768273 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_4 Ig_2 fn3 I-set ig DBD_Tnp_Mut
Motif
Other DBs
NCBI-GeneID: 768273
NCBI-ProteinID: NP_001070881
Ensembl: ENSFCAG00000015571
UniProt: O02744
Position
A1
AA seq 329 aa AA seqDB search
MHPQQLVIAWLSLVLLAPPLMAIWELEKNVYVVELDWHPDAPGEMVVLTCNTPEEDDITW
TSDQSSEVLGSGKTLTIQVKEFADAGQYTCHKGGEVLSHSFLLIHKKEDGIWSTDILREQ
KESKNKIFLKCEAKNYSGRFTCWWLTAISTDLKFTVKSSRGSSDPQEVTCGAATLSAEKV
RVDNRDYKKYTVECQEGSACPAAEESLPIEVVVDAIHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFGVQVQGKNNREKKDRLSVDKTSAKVV
CHKDAKIRVQARDRYYSSSWSNWASVSCS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctcagcagttggtcatcgcctggctttccctggttttgctggcacctcccctc
atggccatatgggaactggagaaaaacgtttatgttgtagagttggactggcaccctgat
gcccccggagaaatggtggtcctcacctgcaatactcctgaagaagatgacatcacctgg
acctctgaccagagcagtgaagtcctaggctctggtaaaactctgaccatccaagtcaaa
gaatttgcagatgctggccagtatacctgtcataaaggaggcgaggttctgagccattcg
ttcctcctgatacacaaaaaggaagatggaatttggtccactgatatcttaagggaacag
aaagaatccaaaaataagatctttctaaaatgtgaggcaaagaattattctggacgtttc
acctgctggtggctgacggcaatcagtaccgatttgaaattcactgtcaaaagcagcaga
ggctcctctgacccccaagaggtgacttgtggagcagcgacactctcagcagagaaggtc
agagtggacaacagggattataagaagtacacagtggagtgtcaggagggcagtgcctgc
ccggctgccgaggagagcctacccattgaagtcgtggtggacgctattcacaagctcaag
tacgaaaactacaccagcagcttcttcatcagggacatcatcaaaccggacccacccaag
aacctgcaactgaagccattaaaaaattctcggcatgtggaagtgagctgggaataccct
gacacctggagcaccccacattcctacttctccttaacatttggcgtacaggtccagggc
aagaacaacagagaaaagaaagacagactctccgtggacaagacctcagccaaggtcgtg
tgccacaaggatgccaagatccgcgtgcaagccagagaccgctactatagctcatcctgg
agcaactgggcatccgtgtcctgcagttag

DBGET integrated database retrieval system