KEGG   Felis catus (domestic cat): 493755Help
Entry
493755            CDS       T02385                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor precursor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04071  Sphingolipid signaling pathway
fca04150  mTOR signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04350  TGF-beta signaling pathway
fca04380  Osteoclast differentiation
fca04612  Antigen processing and presentation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04640  Hematopoietic cell lineage
fca04650  Natural killer cell mediated cytotoxicity
fca04657  IL-17 signaling pathway
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04940  Type I diabetes mellitus
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05310  Asthma
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05414  Dilated cardiomyopathy (DCM)
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493755 (TNF)
   04350 TGF-beta signaling pathway
    493755 (TNF)
   04064 NF-kappa B signaling pathway
    493755 (TNF)
   04668 TNF signaling pathway
    493755 (TNF)
   04071 Sphingolipid signaling pathway
    493755 (TNF)
   04150 mTOR signaling pathway
    493755 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493755 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493755 (TNF)
   04217 Necroptosis
    493755 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493755 (TNF)
   04620 Toll-like receptor signaling pathway
    493755 (TNF)
   04621 NOD-like receptor signaling pathway
    493755 (TNF)
   04622 RIG-I-like receptor signaling pathway
    493755 (TNF)
   04625 C-type lectin receptor signaling pathway
    493755 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    493755 (TNF)
   04612 Antigen processing and presentation
    493755 (TNF)
   04660 T cell receptor signaling pathway
    493755 (TNF)
   04657 IL-17 signaling pathway
    493755 (TNF)
   04664 Fc epsilon RI signaling pathway
    493755 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    493755 (TNF)
  09158 Development
   04380 Osteoclast differentiation
    493755 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    493755 (TNF)
  09163 Immune disease
   05310 Asthma
    493755 (TNF)
   05322 Systemic lupus erythematosus
    493755 (TNF)
   05323 Rheumatoid arthritis
    493755 (TNF)
   05321 Inflammatory bowel disease (IBD)
    493755 (TNF)
   05330 Allograft rejection
    493755 (TNF)
   05332 Graft-versus-host disease
    493755 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493755 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    493755 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493755 (TNF)
   05410 Hypertrophic cardiomyopathy (HCM)
    493755 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    493755 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    493755 (TNF)
   04940 Type I diabetes mellitus
    493755 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493755 (TNF)
   04931 Insulin resistance
    493755 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493755 (TNF)
  09171 Infectious disease: bacterial
   05133 Pertussis
    493755 (TNF)
   05134 Legionellosis
    493755 (TNF)
   05152 Tuberculosis
    493755 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493755 (TNF)
   05170 Human immunodeficiency virus 1 infection
    493755 (TNF)
   05164 Influenza A
    493755 (TNF)
   05161 Hepatitis B
    493755 (TNF)
   05160 Hepatitis C
    493755 (TNF)
   05168 Herpes simplex virus 1 infection
    493755 (TNF)
   05163 Human cytomegalovirus infection
    493755 (TNF)
   05169 Epstein-Barr virus infection
    493755 (TNF)
   05165 Human papillomavirus infection
    493755 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493755 (TNF)
   05144 Malaria
    493755 (TNF)
   05145 Toxoplasmosis
    493755 (TNF)
   05140 Leishmaniasis
    493755 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    493755 (TNF)
   05143 African trypanosomiasis
    493755 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    493755 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493755 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493755 (TNF)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   493755 (TNF)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   493755 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 493755
NCBI-ProteinID: NP_001009835
Ensembl: ENSFCAG00000004499
UniProt: P19101
Position
B2
AA seq 233 aa AA seqDB search
MSTESMIRDVELAEEALPKKAGGPQGSGRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQRLSRRANALLANGVELT
DNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHAISRFAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSTEINLPAYLDFAESGQVYFGIIAL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag
gcagggggcccccagggctccggaaggtgcttgtgcctcagcctcttctccttcctcctc
gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagctcccacatggcctgcaactaatcaaccctctgccccagacactcagatcatct
tctcgaactccgagtgacaagccagtagcccatgtagtagcaaaccccgaagctgaaggg
caactccagcggctgagccggcgtgccaatgccctcctggccaatggcgtggagctgaca
gacaaccaactgaaggtgccctcagacgggctgtacctcatctactcccaggtcctcttc
acgggccaaggatgtccttccacacatgtgctcctcacccacgccatcagccgctttgcc
gtttcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctacctgggaggggtcttc
caactggagaagggtgatcgactcagcactgagatcaatctgcctgcctatcttgacttt
gccgagtctgggcaagtctactttgggatcattgccctgtga

DBGET integrated database retrieval system