KEGG   Felis catus (domestic cat): 493802Help
Entry
493802            CDS       T02385                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28 precursor
  KO
K06470  CD28 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules (CAMs)
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05162  Measles
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05320  Autoimmune thyroid disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    493802 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    493802 (CD28)
   04672 Intestinal immune network for IgA production
    493802 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493802 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    493802 (CD28)
   05323 Rheumatoid arthritis
    493802 (CD28)
   05320 Autoimmune thyroid disease
    493802 (CD28)
   05330 Allograft rejection
    493802 (CD28)
   05332 Graft-versus-host disease
    493802 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    493802 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493802 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    493802 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493802 (CD28)
CD molecules [BR:fca04090]
 Proteins
  493802 (CD28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 V-set SUA5
Motif
Other DBs
NCBI-GeneID: 493802
NCBI-ProteinID: NP_001009844
Ensembl: ENSFCAG00000014271
UniProt: Q9N2I4
Position
C1
AA seq 221 aa AA seqDB search
MILRLLLALNFFPSIQVTENKILVKQLPRLVVYNNEVNLSCKYTHNLFSKEFRASLYKGV
DSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYP
PPYIDNEKSNGTIIHVKEKHLCPAQLSPESSKPFWALVVVGGILGFYSLLATVALGACWM
KTKRSRILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcaggctgcttctggctctcaacttcttcccctcaattcaagtaacagaaaac
aagattttggtgaagcagttgcccaggcttgtggtgtacaacaatgaggtcaaccttagc
tgcaagtacactcacaacctcttctcaaaggagttccgggcatccctttataagggagta
gatagtgctgtggaagtctgcgttgtgaatggaaattactcccatcagcctcagttctac
tcaagtacaggattcgactgtgatgggaaattgggcaatgaaacagtgacattctacctc
cgaaatttgtttgttaaccaaacggatatttacttctgcaaaattgaagtcatgtaccca
cctccttacatagacaatgagaagagcaatgggaccattatccacgtgaaagagaaacat
ctttgtccagctcagctgtctcctgaatcttccaagccattttgggcactggtggtggtt
ggtggaatcctaggtttctacagcttgctagcaacagtggctcttggtgcttgctggatg
aagaccaagaggagtaggatccttcagagtgactatatgaacatgaccccccggaggcca
gggcccacccgaaggcactaccaaccctacgccccagcacgcgactttgcggcataccgt
tcctga

DBGET integrated database retrieval system