KEGG   Felis catus (domestic cat): 493803Help
Entry
493803            CDS       T02385                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5 precursor
  KO
K05428  interleukin 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  Jak-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04672  Intestinal immune network for IgA production
fca05200  Pathways in cancer
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493803 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493803 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493803 (IL5)
   04660 T cell receptor signaling pathway
    493803 (IL5)
   04658 Th1 and Th2 cell differentiation
    493803 (IL5)
   04657 IL-17 signaling pathway
    493803 (IL5)
   04664 Fc epsilon RI signaling pathway
    493803 (IL5)
   04672 Intestinal immune network for IgA production
    493803 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493803 (IL5)
  09163 Immune disease
   05310 Asthma
    493803 (IL5)
   05320 Autoimmune thyroid disease
    493803 (IL5)
   05321 Inflammatory bowel disease (IBD)
    493803 (IL5)
   05330 Allograft rejection
    493803 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493803 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493803 (IL5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   493803 (IL5)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   493803 (IL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL5
Motif
Other DBs
NCBI-GeneID: 493803
NCBI-ProteinID: NP_001009845
Ensembl: ENSFCAG00000013321
UniProt: O77515
Position
A1
AA seq 134 aa AA seqDB search
MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH
QLCIEEVFQGIDTLKNRTVPGDAVEKLFRNLSLIKEHIDRQKKKCGGERWRVKKFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt
gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat
cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac
caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgtgccg
ggggatgctgtggaaaagcttttccgaaacttgtctttaataaaagaacacatagaccgc
caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system