KEGG   Felis catus (domestic cat): 493804Help
Entry
493804            CDS       T02385                                 

Gene name
INS
Definition
(RefSeq) insulin precursor
  KO
K04526  insulin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04911  Insulin secretion
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04940  Type I diabetes mellitus
fca04950  Maturity onset diabetes of the young
fca04960  Aldosterone-regulated sodium reabsorption
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    493804 (INS)
   04015 Rap1 signaling pathway
    493804 (INS)
   04010 MAPK signaling pathway
    493804 (INS)
   04066 HIF-1 signaling pathway
    493804 (INS)
   04068 FoxO signaling pathway
    493804 (INS)
   04072 Phospholipase D signaling pathway
    493804 (INS)
   04022 cGMP-PKG signaling pathway
    493804 (INS)
   04151 PI3K-Akt signaling pathway
    493804 (INS)
   04152 AMPK signaling pathway
    493804 (INS)
   04150 mTOR signaling pathway
    493804 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    493804 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    493804 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493804 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    493804 (INS)
   04910 Insulin signaling pathway
    493804 (INS)
   04923 Regulation of lipolysis in adipocytes
    493804 (INS)
   04913 Ovarian steroidogenesis
    493804 (INS)
   04914 Progesterone-mediated oocyte maturation
    493804 (INS)
   04917 Prolactin signaling pathway
    493804 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    493804 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    493804 (INS)
   04213 Longevity regulating pathway - multiple species
    493804 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    493804 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    493804 (INS)
   04940 Type I diabetes mellitus
    493804 (INS)
   04950 Maturity onset diabetes of the young
    493804 (INS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493804 (INS)
   04931 Insulin resistance
    493804 (INS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin Ins_beta
Motif
Other DBs
NCBI-GeneID: 493804
NCBI-ProteinID: NP_001009272
Ensembl: ENSFCAG00000024114
UniProt: P06306
Position
D1
AA seq 110 aa AA seqDB search
MAPWTRLLPLLALLSLWIPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED
LQGKDAELGEAPGAGGLQPSALEAPLQKRGIVEQCCASVCSLYQLEHYCN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccccgtggacgcgcctcctgcccctgctggcgttgctgtccctctggatccctgcc
ccgacccgagccttcgttaaccagcacctttgtggctcccacctggtggaggcgctgtac
ctggtgtgcggggagcgcggcttcttctacacgcccaaggcccgccgggaggcggaggac
ctccaggggaaggacgcggagctgggggaggcgcctggcgccggcggcctgcagccctcg
gccctggaggcgcccctgcagaagcggggcatcgtggagcaatgctgtgccagcgtctgc
tcgctgtaccagctggagcattactgcaactag

DBGET integrated database retrieval system