KEGG   Felis catus (domestic cat): 493836Help
Entry
493836            CDS       T02385                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04072  Phospholipase D signaling pathway
fca04218  Cellular senescence
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05142  Chagas disease (American trypanosomiasis)
fca05144  Malaria
fca05146  Amoebiasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05219  Bladder cancer
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    493836 (CXCL8)
   04072 Phospholipase D signaling pathway
    493836 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493836 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    493836 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493836 (CXCL8)
   04621 NOD-like receptor signaling pathway
    493836 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    493836 (CXCL8)
   04657 IL-17 signaling pathway
    493836 (CXCL8)
   04062 Chemokine signaling pathway
    493836 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493836 (CXCL8)
   05202 Transcriptional misregulation in cancer
    493836 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    493836 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493836 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493836 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493836 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493836 (CXCL8)
   05133 Pertussis
    493836 (CXCL8)
   05134 Legionellosis
    493836 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    493836 (CXCL8)
   05161 Hepatitis B
    493836 (CXCL8)
   05163 Human cytomegalovirus infection
    493836 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493836 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493836 (CXCL8)
   05144 Malaria
    493836 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    493836 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493836 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493836 (CXCL8)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493836 (CXCL8)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Chemokines
   493836 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 493836
NCBI-ProteinID: NP_001009281
Ensembl: ENSFCAG00000004666
UniProt: Q9XSX5
Position
B1
AA seq 101 aa AA seqDB search
MTSKLVVALLAAFMLSAALCEAAVLSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt
gaagctgcagttttgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

DBGET integrated database retrieval system