KEGG   Felis catus (domestic cat): 493837Help
Entry
493837            CDS       T02385                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04071  Sphingolipid signaling pathway
fca04115  p53 signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04722  Neurotrophin signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05020  Prion diseases
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    493837 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    493837 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493837 (BAX)
   04215 Apoptosis - multiple species
    493837 (BAX)
   04217 Necroptosis
    493837 (BAX)
   04115 p53 signaling pathway
    493837 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    493837 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    493837 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493837 (BAX)
   05202 Transcriptional misregulation in cancer
    493837 (BAX)
   05203 Viral carcinogenesis
    493837 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493837 (BAX)
   05212 Pancreatic cancer
    493837 (BAX)
   05225 Hepatocellular carcinoma
    493837 (BAX)
   05226 Gastric cancer
    493837 (BAX)
   05214 Glioma
    493837 (BAX)
   05216 Thyroid cancer
    493837 (BAX)
   05220 Chronic myeloid leukemia
    493837 (BAX)
   05217 Basal cell carcinoma
    493837 (BAX)
   05218 Melanoma
    493837 (BAX)
   05213 Endometrial cancer
    493837 (BAX)
   05224 Breast cancer
    493837 (BAX)
   05222 Small cell lung cancer
    493837 (BAX)
   05223 Non-small cell lung cancer
    493837 (BAX)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    493837 (BAX)
   05016 Huntington disease
    493837 (BAX)
   05020 Prion diseases
    493837 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493837 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493837 (BAX)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493837 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493837 (BAX)
   05170 Human immunodeficiency virus 1 infection
    493837 (BAX)
   05162 Measles
    493837 (BAX)
   05164 Influenza A
    493837 (BAX)
   05161 Hepatitis B
    493837 (BAX)
   05160 Hepatitis C
    493837 (BAX)
   05168 Herpes simplex virus 1 infection
    493837 (BAX)
   05163 Human cytomegalovirus infection
    493837 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493837 (BAX)
   05169 Epstein-Barr virus infection
    493837 (BAX)
   05165 Human papillomavirus infection
    493837 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493837 (BAX)
   01524 Platinum drug resistance
    493837 (BAX)
   01522 Endocrine resistance
    493837 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    493837 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    493837 (BAX)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    493837 (BAX)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   493837 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 CF222
Motif
Other DBs
NCBI-GeneID: 493837
NCBI-ProteinID: NP_001009282
Ensembl: ENSFCAG00000000258
UniProt: Q8SQ43
Position
E2
AA seq 192 aa AA seqDB search
MDGSGEQPRGGGHTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLAIWKKMG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcacaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaagatcgagcagggcgaatgggggga
gagacgcccgagctggccctggagcaggtgccccaggacgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggagatgaactggacagtaacatggaattgcagaggatgatc
gcagctgtggacacagactccccccgcgaggtctttttccgagtggcagcggagatgttt
tccgatggcaacttcaactggggccgggtcgttgccctcttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgagctgatccggaccatcatgggctggaca
ctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggcgggagtg
ctgactgcgtcactcgccatctggaaaaagatgggctga

DBGET integrated database retrieval system