KEGG   Felis catus (domestic cat): 493847Help
Entry
493847            CDS       T02385                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04071  Sphingolipid signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04137  Mitophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04216  Ferroptosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04722  Neurotrophin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493847 (TP53)
   04310 Wnt signaling pathway
    493847 (TP53)
   04071 Sphingolipid signaling pathway
    493847 (TP53)
   04151 PI3K-Akt signaling pathway
    493847 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    493847 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    493847 (TP53)
   04210 Apoptosis
    493847 (TP53)
   04216 Ferroptosis
    493847 (TP53)
   04115 p53 signaling pathway
    493847 (TP53)
   04218 Cellular senescence
    493847 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    493847 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    493847 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    493847 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493847 (TP53)
   05202 Transcriptional misregulation in cancer
    493847 (TP53)
   05206 MicroRNAs in cancer
    493847 (TP53)
   05205 Proteoglycans in cancer
    493847 (TP53)
   05203 Viral carcinogenesis
    493847 (TP53)
   05230 Central carbon metabolism in cancer
    493847 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493847 (TP53)
   05212 Pancreatic cancer
    493847 (TP53)
   05225 Hepatocellular carcinoma
    493847 (TP53)
   05226 Gastric cancer
    493847 (TP53)
   05214 Glioma
    493847 (TP53)
   05216 Thyroid cancer
    493847 (TP53)
   05220 Chronic myeloid leukemia
    493847 (TP53)
   05217 Basal cell carcinoma
    493847 (TP53)
   05218 Melanoma
    493847 (TP53)
   05219 Bladder cancer
    493847 (TP53)
   05215 Prostate cancer
    493847 (TP53)
   05213 Endometrial cancer
    493847 (TP53)
   05224 Breast cancer
    493847 (TP53)
   05222 Small cell lung cancer
    493847 (TP53)
   05223 Non-small cell lung cancer
    493847 (TP53)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    493847 (TP53)
   05016 Huntington disease
    493847 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493847 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493847 (TP53)
   05162 Measles
    493847 (TP53)
   05161 Hepatitis B
    493847 (TP53)
   05160 Hepatitis C
    493847 (TP53)
   05168 Herpes simplex virus 1 infection
    493847 (TP53)
   05163 Human cytomegalovirus infection
    493847 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493847 (TP53)
   05169 Epstein-Barr virus infection
    493847 (TP53)
   05165 Human papillomavirus infection
    493847 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493847 (TP53)
   01522 Endocrine resistance
    493847 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    493847 (TP53)
   03036 Chromosome and associated proteins [BR:fca03036]
    493847 (TP53)
   03400 DNA repair and recombination proteins [BR:fca03400]
    493847 (TP53)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    493847 (TP53)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     493847 (TP53)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    493847 (TP53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind DEC-1_N
Motif
Other DBs
NCBI-GeneID: 493847
NCBI-ProteinID: NP_001009294
Ensembl: ENSFCAG00000009623
UniProt: P41685 A0A059UCX8
Position
E1
AA seq 386 aa AA seqDB search
MQEPPLELTIEPPLSQETFSELWNLLPENNVLSSELSSAMNELPLSEDVANWLDEAPDDA
SGMSAVPAPAAPAPATPAPAISWPLSSFVPSQKTYPGAYGFHLGFLQSGTAKSVTCTYSP
PLNKLFCQLAKTCPVQLWVRSPPPPGTCVRAMAIYKKSEFMTEVVRRCPHHERCPDSSDG
LAPPQHLIRVEGNLHAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMN
RRPIITIITLEDSNGKLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRA
LPPSTSSTPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQSGKEPGGSRAHSS
HLKAKKGQSTSRHKKPMLKREGLDSD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagccgccgttggaactcaccatcgagccccctctgagccaggagacattttcg
gaattgtggaacctacttcccgaaaacaatgttctgtcttccgaactgtcctcagcgatg
aatgagctgccgctctcggaagatgtcgcaaactggctggatgaagcaccagatgatgct
tccggaatgtcagcggttccggcacccgcagcccctgcgccagccacccctgcgccagcc
atctcctggcccctgtcatcctttgtcccttcgcagaagacctacccgggcgcctatggt
ttccatttagggttcctgcagtcggggacagccaagtcggttacttgcacgtactcccct
cccctcaacaagctgttttgccagctggcgaagacctgccccgtgcagctgtgggtccga
tcgccgcccccaccgggaacctgtgtccgcgccatggccatttacaagaagtcagagttc
atgacagaggtcgtgaggcgctgtccccaccacgagcgctgccctgacagtagcgatggt
ctggcgcctccccagcatctcatccgagtggaaggaaacttgcatgccaagtacctggac
gacagaaacactttccgacatagcgtcgtggtgccctacgagccgcccgaggtcggctct
gactgtaccaccatccactacaatttcatgtgtaacagttcctgcatggggggcatgaac
cggaggcccatcatcaccatcatcaccctggaagactccaatgggaagctgctgggacgg
aacagcttcgaggtacgagtttgtgcctgtcctgggagagaccggcgcaccgaggaggaa
aatttccgcaagaagggggagccttgccctgagccgccccctgggagcactaagcgagcg
ctgccccccagcaccagctctactcccccacaaaagaagaagccactggatggagaatat
ttcacccttcagatccgtgggcgtgaacgcttcgagatgttccgagagctgaatgaggcc
ttggagctgaaggatgcccagagtggaaaggagccaggcggaagcagggctcactccagc
cacctgaaggctaagaaggggcagtctacctcccgccataaaaagccaatgttgaagaga
gaggggctcgactcagactga

DBGET integrated database retrieval system