KEGG   Felis catus (domestic cat): 493849Help
Entry
493849            CDS       T02385                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04668  TNF signaling pathway
fca05142  Chagas disease (American trypanosomiasis)
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493849 (IFNB1)
   04668 TNF signaling pathway
    493849 (IFNB1)
   04151 PI3K-Akt signaling pathway
    493849 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493849 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493849 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493849 (IFNB1)
   04621 NOD-like receptor signaling pathway
    493849 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    493849 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    493849 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    493849 (IFNB1)
  09158 Development
   04380 Osteoclast differentiation
    493849 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493849 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493849 (IFNB1)
   05162 Measles
    493849 (IFNB1)
   05164 Influenza A
    493849 (IFNB1)
   05161 Hepatitis B
    493849 (IFNB1)
   05160 Hepatitis C
    493849 (IFNB1)
   05168 Herpes simplex virus 1 infection
    493849 (IFNB1)
   05163 Human cytomegalovirus infection
    493849 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493849 (IFNB1)
   05169 Epstein-Barr virus infection
    493849 (IFNB1)
   05165 Human papillomavirus infection
    493849 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    493849 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493849 (IFNB1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493849 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 493849
NCBI-ProteinID: NP_001009297
Ensembl: ENSFCAG00000004604
UniProt: Q9N2J0 A1YQW1
Position
D4
AA seq 186 aa AA seqDB search
MTGRCILQIALLVCFFTTAHSVSYKLLGFQLRSSSLECQELLVNLNRTSKYCLKDRMNFE
VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRSTSSTGWNETTVENLLATLHWQKEHLE
TILEEIMEEENFTWDNTTLLNLKKYYLRIVRYLKAKEYSVCAWTVVHAEILRNFFFLERL
TDYLQN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaggtgcatcctccaaatcgctctcttggtgtgtttcttcaccaccgcgcat
tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag
ctcctggtgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag
gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc
aacgagatgttccagaagatctttaatattttcagtagaagcacctctagcacgggatgg
aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa
acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg
aacctgaagaaatactacttaaggattgtgcggtacctgaaggccaaggagtacagcgtc
tgtgcctggacagtagtccacgcagaaatcctcagaaactttttcttccttgagagactt
acagattacctccaaaactga

DBGET integrated database retrieval system