KEGG   Felis catus (domestic cat): 493850
Entry
493850            CDS       T02385                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca05144  Malaria
fca05145  Toxoplasmosis
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05322  Systemic lupus erythematosus
fca05330  Allograft rejection
fca05340  Primary immunodeficiency
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    493850 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493850 (CD40LG)
   04514 Cell adhesion molecules
    493850 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    493850 (CD40LG)
   04672 Intestinal immune network for IgA production
    493850 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    493850 (CD40LG)
   05322 Systemic lupus erythematosus
    493850 (CD40LG)
   05320 Autoimmune thyroid disease
    493850 (CD40LG)
   05330 Allograft rejection
    493850 (CD40LG)
   05340 Primary immunodeficiency
    493850 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    493850 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    493850 (CD40LG)
   05145 Toxoplasmosis
    493850 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493850 (CD40LG)
   04090 CD molecules [BR:fca04090]
    493850 (CD40LG)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   493850 (CD40LG)
CD molecules [BR:fca04090]
 Proteins
  493850 (CD40LG)
SSDB
Motif
Pfam: TNF Mit_ribos_Mrp51
Other DBs
NCBI-GeneID: 493850
NCBI-ProteinID: NP_001009298
Ensembl: ENSFCAG00000004168
UniProt: O97605
Position
X
AA seq 260 aa
MIETYSQTAPRSVAPGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLY
EDFVFMKTLQKCNKGEGALSLLNCEEIKSRFEAFLKEIMLNKETKKEKNVAMQKGDQDPR
VAAHVISEASSSTASVLQWAPKGYYTISSNLVTLENGKQLAVKRQGLYYIYAQVTFCSNR
EASSQAPFIASLCLHSPSGSERVLLRAANARSSSKPCGQQSIHLGGVFELHPGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatagaaacatacagccaaactgctccccgctccgtggcccctggaccacccgtcagt
atgaaaatttttatgtatttacttactgtgtttctcatcacccagatgattgggtcagca
ctctttgctgtgtatcttcacagaagactggacaagatagaagatgaaaggaatctttat
gaagattttgtgttcatgaaaacattacagaaatgcaacaaaggagagggggccttatcc
ttactgaactgtgaggaaattaaaagccggtttgaagcctttctcaaggagataatgcta
aacaaagaaacgaagaaagaaaaaaatgttgcaatgcaaaaaggcgaccaggatcctcga
gttgcagcacatgtcataagtgaggccagcagtagcacagcgtctgttctccagtgggcc
cccaaaggctactacaccataagcagcaacttggtgaccctcgagaacgggaagcagctg
gccgttaaaagacaaggactctattatatctacgcccaagtcaccttctgttccaatcgg
gaagcttcgagtcaagctccgttcatagccagcctctgcctgcattccccgagtggatcc
gagagagtcttactcagagctgcaaatgcccgcagttcctccaaaccctgtgggcagcaa
tccattcacttgggaggagtcttcgaactgcatccaggtgcttcggtgttcgtgaacgtg
actgatccgagccaagtgagccacgggacgggcttcacgtcttttggcttactcaaactc
tga

DBGET integrated database retrieval system