KEGG   Felis catus (domestic cat): 493881Help
Entry
493881            CDS       T02385                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 precursor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04668  TNF signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04940  Type I diabetes mellitus
fca05010  Alzheimer disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493881 (FAS)
   04668 TNF signaling pathway
    493881 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493881 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493881 (FAS)
   04217 Necroptosis
    493881 (FAS)
   04115 p53 signaling pathway
    493881 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    493881 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493881 (FAS)
   05205 Proteoglycans in cancer
    493881 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493881 (FAS)
   05330 Allograft rejection
    493881 (FAS)
   05332 Graft-versus-host disease
    493881 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493881 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493881 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493881 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493881 (FAS)
   05162 Measles
    493881 (FAS)
   05164 Influenza A
    493881 (FAS)
   05161 Hepatitis B
    493881 (FAS)
   05160 Hepatitis C
    493881 (FAS)
   05168 Herpes simplex virus 1 infection
    493881 (FAS)
   05163 Human cytomegalovirus infection
    493881 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493881 (FAS)
   05169 Epstein-Barr virus infection
    493881 (FAS)
   05165 Human papillomavirus infection
    493881 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    493881 (FAS)
   05143 African trypanosomiasis
    493881 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493881 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493881 (FAS)
   04090 CD molecules [BR:fca04090]
    493881 (FAS)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   493881 (FAS)
CD molecules [BR:fca04090]
 Proteins
  493881 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6 Stn1_C
Motif
Other DBs
NCBI-GeneID: 493881
NCBI-ProteinID: NP_001009314
Ensembl: ENSFCAG00000007187
UniProt: Q861W6
Position
D2
AA seq 314 aa AA seqDB search
MKGPWAVRWLILTSVAGSLFRGDSAQVTDVSSKVLKLSKNATEGEPGCKEGLHRGSKFCC
LPCPPGTRKAADCEEDGGRPSCIPCEEAKDYTDRSHFSPRCRRCKICDEEHGLEVEKNCT
RTQNTKCRCKSNFFCNVSQCDHCNPCMMCEHGILENCTPTSSTKCKQGSSSKLLWLCALL
LILPSALVCCCVLKKYGNTKNGRRESTVSVTESMPMNFTDIDLSKYISSIAEQMKITQVR
EFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKGAYYALVKGLRKANLCAL
AEKIEDMVQKDSAS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggccctgggccgtccgttggctgatacttacctctgttgccggatccctgttc
agaggcgacagcgctcaggtcaccgatgtcagctccaaggtgttgaaattgagtaagaac
gctaccgaaggggagcctggatgcaaggaaggtctgcatcgtgggagcaagttctgctgt
ctgccatgccctcctggcacacgaaaagctgccgactgtgaagaagatgggggtagacca
tcctgtataccctgtgaagaagcgaaggactacacagacaggagccatttttctcccaga
tgcagaagatgtaaaatttgtgatgaagagcatggcttagaagtggaaaaaaactgtacc
cggacccagaataccaagtgcagatgtaaatcaaactttttttgtaacgtctctcagtgt
gaccactgtaacccgtgcatgatgtgtgaacatggaatccttgagaattgcacaccaacc
agcagcaccaaatgtaaacaaggatccagctccaaacttctgtggctttgtgccctgctc
ctgattctaccgtccgcactagtgtgttgctgtgtgttgaaaaagtacgggaatacgaag
aatggccgccgggaatctacagtctcagttactgagagtatgccgatgaatttcacagac
atcgacttgagtaaatacatcagtagcattgccgaacaaatgaaaataactcaagtcaga
gaatttgtccgcaagaatggtatcaacgaagccaaaatagacgagatcaagaacgacaac
ctccaagacacagctgaacagaaagtccaactgctccggaattggtaccagctccacggg
aggaagggcgcgtattacgctctggtgaaaggtctcaggaaagccaatctctgcgctctt
gccgagaaaattgaagatatggtccagaaggacagtgcgagctaa

DBGET integrated database retrieval system