KEGG   Felis catus (domestic cat): 493925Help
Entry
493925            CDS       T02385                                 

Gene name
ZP3
Definition
(RefSeq) zona pellucida sperm-binding protein 3 precursor
  KO
K19928  zona pellucida sperm-binding protein 3
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493925 (ZP3)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    493925 (ZP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 493925
NCBI-ProteinID: NP_001009330
Ensembl: ENSFCAG00000013474
UniProt: P48832
Position
E3
AA seq 424 aa AA seqDB search
MGLSYGLFICFLLWAGTGLCYPPTTTEDKTHPSLPSSPSVVVECRHAWLVVNVSKNLFGT
GRLVRPADLTLWPENCEPLISGDSDDTVRFEVELHKCGNSVQVTEDALVYSTFLLHNPRP
MGNLSILRTNRAEVPIECRYPRHSNVSSEAILPTWVPFRTTMLSEEKLAFSLRLMEEDWG
SEKQSPTFQLGDLAHLQAEVHTGRHIPLRLFVDYCVATLTPDQNASPHHTIVDFHGCLVD
GLSDASSAFKAPRPRPETLQFTVYTFHFANDPRNMIYITCHLKVTPASRVPDQLNKACSF
IKSSNRWFPVEGPADICNCCNKGSCGLQGRSWRLSHLDRPWHKMASRNRRHVTEEADITV
GPLIFLGKAADRGVEGSTSPHTSVMVGIGLATVLSLTLATIVLGLARRHHTASRPMICPV
SASQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggggctgagctacgggcttttcatctgttttctgctttgggcaggcacggggctgtgc
tatcccccaaccaccaccgaggataagacccacccctcgttgccatcaagcccctctgtg
gtggtagagtgtcggcatgcctggctggtggtcaacgtcagcaaaaacctttttggtact
gggaggcttgtgaggcctgcagacctcaccctgtggccggagaactgtgagcccctgatc
tctggggactcagatgatacggtcaggtttgaagtcgagctgcacaagtgtggcaacagc
gtgcaggtgaccgaagatgccctggtgtatagcaccttcctgctccacaacccccgcccc
atgggaaacctgtccatcctgaggaccaaccgcgcggaagttcccattgagtgccgttac
cccaggcatagcaacgtgagcagcgaggccatcctgcccacctgggtgcccttcaggacc
acaatgctctcagaggagaagctggctttctctctgcgcctgatggaggaggactggggc
tccgagaagcagtcccccactttccagttgggagacctagcccacctccaggccgaagtc
cacaccggccgccacataccactgcgactgtttgtggactactgtgtggccacgctgaca
ccagaccagaacgcctctcctcatcacaccatcgtggacttccacggctgtctcgtggat
ggtctctctgatgcctcttctgccttcaaagcccccagacccaggccggagactctccag
ttcacagtatacacgttccactttgctaatgaccccagaaacatgatctatatcacctgc
catctgaaagtcactccagctagccgagtcccggaccagctaaacaaagcctgttccttc
atcaagtcttctaacaggtggttcccagtagaaggccctgctgacatctgtaactgttgt
aacaaaggtagctgtggccttcagggccgttcctggaggctgtcccacctagacagaccg
tggcacaagatggcttcccgaaatcgcaggcatgtgaccgaagaagcggatatcaccgtg
gggcctctgatcttcctgggaaaggctgccgatcgtggtgtggaggggtcgacctcgcct
cacacctctgtgatggtgggcataggcctggccacggtgttgtccctgactctggctacc
attgtcctgggtctcgccaggaggcatcacactgcttcccgtcctatgatctgccctgtg
tctgcttcccaataa

DBGET integrated database retrieval system