KEGG   Felis catus (domestic cat): 493932Help
Entry
493932            CDS       T02385                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04650  Natural killer cell mediated cytotoxicity
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04726  Serotonergic synapse
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05133  Pertussis
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Module
fca_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493932 (CASP3)
   04668 TNF signaling pathway
    493932 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493932 (CASP3)
   04215 Apoptosis - multiple species
    493932 (CASP3)
   04115 p53 signaling pathway
    493932 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    493932 (CASP3)
   04657 IL-17 signaling pathway
    493932 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    493932 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493932 (CASP3)
   05206 MicroRNAs in cancer
    493932 (CASP3)
   05205 Proteoglycans in cancer
    493932 (CASP3)
   05203 Viral carcinogenesis
    493932 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493932 (CASP3)
   05222 Small cell lung cancer
    493932 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493932 (CASP3)
   05012 Parkinson disease
    493932 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    493932 (CASP3)
   05016 Huntington disease
    493932 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    493932 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493932 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493932 (CASP3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    493932 (CASP3)
   05134 Legionellosis
    493932 (CASP3)
   05152 Tuberculosis
    493932 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493932 (CASP3)
   05162 Measles
    493932 (CASP3)
   05164 Influenza A
    493932 (CASP3)
   05161 Hepatitis B
    493932 (CASP3)
   05160 Hepatitis C
    493932 (CASP3)
   05168 Herpes simplex virus 1 infection
    493932 (CASP3)
   05163 Human cytomegalovirus infection
    493932 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493932 (CASP3)
   05169 Epstein-Barr virus infection
    493932 (CASP3)
   05165 Human papillomavirus infection
    493932 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493932 (CASP3)
   05145 Toxoplasmosis
    493932 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493932 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    493932 (CASP3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     493932 (CASP3)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C14: caspase family
   493932 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 493932
NCBI-ProteinID: NP_001009338
Ensembl: ENSFCAG00000025408
UniProt: Q8MJU1
Position
B1
AA seq 277 aa AA seqDB search
MENSENSVDAKSIKNSETKIFHGSKSMDSGIYMDNSYKMDYPEMGLCIIINNKNFHESTG
MPSRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIVALLDSVSREDHSKRSSFICVLLS
HGEEGIIYGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTED
DIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHELEFMHILTRVN
RKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtgaaaactcagtggatgcaaaatccattaaaaattccgaaacaaagatc
ttccatggaagcaaatcaatggactctggaatatacatggacaacagttacaaaatggat
taccctgaaatgggtttatgtataataattaataataagaactttcatgaaagtaccgga
atgccgtctcggtctggtacagatgtggatgcggcgaacctccgagaaacattcacaaac
ttaaaatacgaagtcaggaataaaaacgatcttacacgcgaacaaattgtggcgttgctg
gacagtgtttctagagaagatcatagcaaaaggagcagttttatttgcgtgcttctaagc
catggtgaagaaggaatcatttatggaacaaacggacctgttgacctgaaaaaattaaca
ggtttcttcagaggggattattgtagaagtctaaccggcaaacccaaactcttcattatt
caggcctgccgaggcacggaactggactgcggcattgagactgacagtggtaccgaggat
gacatcgcctgtcagaaaataccagtggaggccgacttcttatatgcgtattccacagcc
cctggttactactcctggcgaaattccaaggatggatcctggttcatccagtcactttgc
tcgatgctcagactgtatgctcacgagcttgagttcatgcacattcttactcgggttaac
cgaaaggtggcaacagaatttgagtccttttctcttgactctgcttttcatggaaagaaa
cagattccatgtattgtgtctatgctcacaaaagaactatatttttatcactaa

DBGET integrated database retrieval system