KEGG   Felis catus (domestic cat): 493934Help
Entry
493934            CDS       T02385                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04071  Sphingolipid signaling pathway
fca04115  p53 signaling pathway
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04340  Hedgehog signaling pathway
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04915  Estrogen signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    493934 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    493934 (BCL2)
   04630 Jak-STAT signaling pathway
    493934 (BCL2)
   04064 NF-kappa B signaling pathway
    493934 (BCL2)
   04066 HIF-1 signaling pathway
    493934 (BCL2)
   04071 Sphingolipid signaling pathway
    493934 (BCL2)
   04151 PI3K-Akt signaling pathway
    493934 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    493934 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    493934 (BCL2)
   04215 Apoptosis - multiple species
    493934 (BCL2)
   04217 Necroptosis
    493934 (BCL2)
   04115 p53 signaling pathway
    493934 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493934 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493934 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    493934 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    493934 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    493934 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    493934 (BCL2)
   04722 Neurotrophin signaling pathway
    493934 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493934 (BCL2)
   05206 MicroRNAs in cancer
    493934 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493934 (BCL2)
   05226 Gastric cancer
    493934 (BCL2)
   05215 Prostate cancer
    493934 (BCL2)
   05222 Small cell lung cancer
    493934 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    493934 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493934 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    493934 (BCL2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493934 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493934 (BCL2)
   05162 Measles
    493934 (BCL2)
   05161 Hepatitis B
    493934 (BCL2)
   05168 Herpes simplex virus 1 infection
    493934 (BCL2)
   05169 Epstein-Barr virus infection
    493934 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493934 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493934 (BCL2)
   01524 Platinum drug resistance
    493934 (BCL2)
   01522 Endocrine resistance
    493934 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    493934 (BCL2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493934 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 493934
NCBI-ProteinID: NP_001009340
UniProt: Q8I008
Position
D3
AA seq 235 aa AA seqDB search
MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
RTSPPPPPVAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNREMSPLVDNIALWMTEYLNRH
LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tatgagctgccgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg
ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc
aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgctgccgcgggccct
gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc
tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttt
accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggcgtgaactgg
gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagggcgtcaaccga
gagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcac
ctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtacggcccc
agcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagtctggcc
ctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system