KEGG   Felis catus (domestic cat): 493935Help
Entry
493935            CDS       T02385                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04024  cAMP signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04713  Circadian entrainment
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05031  Amphetamine addiction
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05224  Breast cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05323  Rheumatoid arthritis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493935 (FOS)
   04668 TNF signaling pathway
    493935 (FOS)
   04024 cAMP signaling pathway
    493935 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493935 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493935 (FOS)
   04660 T cell receptor signaling pathway
    493935 (FOS)
   04658 Th1 and Th2 cell differentiation
    493935 (FOS)
   04659 Th17 cell differentiation
    493935 (FOS)
   04657 IL-17 signaling pathway
    493935 (FOS)
   04662 B cell receptor signaling pathway
    493935 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    493935 (FOS)
   04917 Prolactin signaling pathway
    493935 (FOS)
   04921 Oxytocin signaling pathway
    493935 (FOS)
   04926 Relaxin signaling pathway
    493935 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    493935 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    493935 (FOS)
   04728 Dopaminergic synapse
    493935 (FOS)
  09158 Development
   04380 Osteoclast differentiation
    493935 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    493935 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493935 (FOS)
   05231 Choline metabolism in cancer
    493935 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493935 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493935 (FOS)
   05224 Breast cancer
    493935 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493935 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    493935 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493935 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493935 (FOS)
   05133 Pertussis
    493935 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493935 (FOS)
   05170 Human immunodeficiency virus 1 infection
    493935 (FOS)
   05162 Measles
    493935 (FOS)
   05161 Hepatitis B
    493935 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493935 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    493935 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    493935 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    493935 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    493935 (FOS)
   04131 Membrane trafficking [BR:fca04131]
    493935 (FOS)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    493935 (FOS)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    493935 (FOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 493935
NCBI-ProteinID: NP_001009341
Ensembl: ENSFCAG00000025370
UniProt: Q8HZP6
Position
B3
AA seq 381 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR
AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL
QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF
TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY
AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR
KGSSSNEPSSDSLSSPTLLAL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg
ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt
atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggctccttcccagaccagagccccccacccctatggagtccccgcc
ccctccgccggggcttactccagggccggagtcgtgaagaccgtgaccgcaggaggccga
gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa
aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg
gagctcacggatacactccaagcggagacagatcaactagaagatgagaagtctgctttg
cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct
caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct
tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc
accctgcccctcctcaatgatcctgagcccaagccctccgtagagccggtcaagagcatc
agcagcatggagctgaaggccgagcccttcgatgacttcctgttcccagcatcgtccagg
cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat
gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag
ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct
tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc
aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc
ctgtga

DBGET integrated database retrieval system